DRD3 angl Dopamine receptor D3 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 3 yi hromosomi 4 Dovzhina polipeptidnogo lancyuga bilka stanovit 400 aminokislot a molekulyarna masa 44 225 5 DRD3Nayavni strukturiPDBPoshuk ortologiv PDBe RCSBSpisok kodiv PDB3PBLIdentifikatoriSimvoliDRD3 D3DR ETM1 FET1 dopamine receptor D3Zovnishni ID OMIM 126451 MGI 94925 HomoloGene 623 GeneCards DRD3Reaguye na spolukuPF 592379 ropinirol rotigotin vilazodone 7 hydroxy 2 di N propylamino tetralin dofamin pramipeksol quinelorane quinpirole Apomorfin do 687 Bromokriptin Kabergolin lisuride pergolide Piribedil roxindole terguride butaclamol hlorpromazin klozapin domperidon eticlopride Flyupentiksol galoperidol Loksapin mesoridazine nafadotride 5 chloro 2 methoxy 4 methylamino N 2 methyl 1 phenylmethyl 3 pyrrolidinyl benzamide perospirone pimozid prohlorperazin Promazin raclopride risperidon SB 277 011 A Sertindol spiperone sulpirid levosulpiride zotepine pimozid droperidol galoperidol Apomorfin thioridazine hydrochloride bromocriptine mesylate chlorpromazine hydrochloride pergolide mesylate promazine hydrochloride 1 Ontologiya genaMolekulyarna funkciya GO 0001948 GO 0016582 protein binding signal transducer activity G protein coupled receptor activity dopamine neurotransmitter receptor activity dopamine neurotransmitter receptor activity coupled via Gi Go dopamine binding protein domain specific binding D1 dopamine receptor binding adrenergic receptor activityKlitinna komponenta endocytic vesicle apical part of cell cell projection integral component of membrane membrana klitinna membrana integral component of plasma membrane dopaminergic synapse glutamatergic synapse GABA ergic synapse integral component of postsynaptic density membraneBiologichnij proces negative regulation of sodium proton antiporter activity dopamine receptor signaling pathway dopamine metabolic process regulation of circadian sleep wake cycle sleep negative regulation of dopamine receptor signaling pathway positive regulation of cell population proliferation regulation of dopamine uptake involved in synaptic transmission response to histamine response to ethanol prepulse inhibition socialna povedinka navchennya positive regulation of renal sodium excretion arachidonic acid secretion negative regulation of protein secretion GO 1901227 negative regulation of transcription by RNA polymerase II gastric emptying regulation of blood volume by renin angiotensin regulation of locomotion involved in locomotory behavior cellular calcium ion homeostasis regulation of locomotion learning or memory response to amphetamine GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II positive regulation of cytokinesis GO 0072468 Signalna transdukciya regulation of lipid metabolic process regulation of multicellular organism growth visual learning G protein coupled receptor internalization regulation of dopamine secretion negative regulation of protein kinase B signaling adenylate cyclase activating dopamine receptor signaling pathway locomotory behavior behavioral response to cocaine negative regulation of blood pressure acid secretion musculoskeletal movement spinal reflex action positive regulation of dopamine receptor signaling pathway circadian regulation of gene expression response to morphine negative regulation of oligodendrocyte differentiation adenylate cyclase inhibiting dopamine receptor signaling pathway positive regulation of mitotic nuclear division response to cocaine synaptic transmission dopaminergic G protein coupled receptor signaling pathway Avtofagiya negative regulation of apoptotic process regulation of neurotransmitter uptake regulation of postsynaptic neurotransmitter receptor internalization adenylate cyclase modulating G protein coupled receptor signaling pathway adenylate cyclase activating adrenergic receptor signaling pathwayDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez1814 13490Ensembl ENSG00000151577 ENSMUSG00000022705UniProt P35462 P30728RefSeq mRNK NM 000796NM 001282563NM 001290809NM 033658NM 033659NM 033660NM 033663NM 007877RefSeq bilok NP 000787NP 001269492NP 001277738NP 387512NP 031903Lokus UCSC Hr 3 114 13 114 2 MbHr 16 43 57 43 64 MbPubMed search 2 3 VikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050MASLSQLSSHLNYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLVCMAVLKERALQTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILNLCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPTVCSISNPDFVIYSSVVSFYLPFGVTVLVYARIYVVLKQRRRKRILTRQNSQCNSVRPGFPQQTLSPDPAHLELKRYYSICQDTALGGPGFQERGGELKREEKTRNSLSPTIAPKLSLEVRKLSNGRLSTSLKLGPLQPRGVPLREKKATQMVAIVLGAFIVCWLPFFLTHVLNTHCQTCHVSPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKILSCA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do receptoriv g bilokspryazhenih receptoriv bilkiv vnutrishnoklitinnogo signalingu Zadiyanij u takih biologichnih procesah yak polimorfizm alternativnij splajsing Lokalizovanij u klitinnij membrani membrani Literatura RedaguvatiSchmauss C Haroutunian V Davis K L Davidson M 1993 Selective loss of dopamine D3 type receptor mRNA expression in parietal and motor cortices of patients with chronic schizophrenia Proc Natl Acad Sci U S A 90 8942 8946 PubMed DOI 10 1073 pnas 90 19 8942 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PubMed DOI 10 1101 gr 2596504 Lucotte G Lagarde J P Funalot B Sokoloff P 2006 Linkage with the Ser9Gly DRD3 polymorphism in essential tremor families Clin Genet 69 437 440 PubMed DOI 10 1111 j 1399 0004 2006 00600 x Giros B Martres M P Sokoloff P Schwartz J C 1990 Gene cloning of human dopaminergic D3 receptor and identification of its chromosome C R Acad Sci III Sci Vie 311 501 508 PubMed Liu K Bergson C Levenson R Schmauss C 1994 On the origin of mRNA encoding the truncated dopamine D3 type receptor D3nf and detection of D3nf like immunoreactivity in human brain J Biol Chem 269 29220 29226 PubMedPrimitki Redaguvati Spoluki yaki fizichno vzayemodiyut z DRD3 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 3024 angl Procitovano 30 serpnya 2017 UniProt P35462 angl Arhiv originalu za 17 serpnya 2017 Procitovano 30 serpnya 2017 Div takozh RedaguvatiHromosoma 3 nbsp Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Otrimano z https uk wikipedia org w index php title DRD3 amp oldid 35598044
