www.wikidata.uk-ua.nina.az
Plazminogen angl Plasminogen bilok yakij koduyetsya genom PLG roztashovanim u lyudej na korotkomu plechi 6 yi hromosomi 5 Dovzhina polipeptidnogo lancyuga bilka stanovit 810 aminokislot a molekulyarna masa 90 569 6 PlazminogenNayavni strukturiPDBPoshuk ortologiv PDBe RCSBSpisok kodiv PDB1B2I 1BML 1BUI 1CEA 1CEB 1DDJ 1HPJ 1HPK 1I5K 1KI0 1KRN 1L4D 1L4Z 1PK4 1PKR 1PMK 1QRZ 1RJX 2DOH 2DOI 2KNF 2L0S 2PK4 3UIR 4A5T 4CIK 4DCB 4DUR 4DUU 5HPGIdentifikatoriSimvoliPLG plasminogen plasmin HAE4Zovnishni ID OMIM 173350 MGI 97620 HomoloGene 55452 GeneCards PLGPov yazani genetichni zahvoryuvannyahypoplasminogenemia 1 Reaguye na spolukuAminokapronova kislota urokinase Tenekteplaza Aminokapronova kislota 2 Ontologiya genaMolekulyarna funkciya apolipoprotein binding protein domain specific binding GO 0070122 peptidase activity GO 0001948 GO 0016582 protein binding serine type peptidase activity signaling receptor binding hydrolase activity serine type endopeptidase activity chaperone binding proteasome core complex binding protein antigen binding endopeptidase activity enzyme binding kinase bindingKlitinna komponenta blood microparticle extracellular region cell surface extrinsic component of external side of plasma membrane ekzosoma platelet alpha granule lumen extracellular space klitinna membrana extrinsic component of plasma membrane vnutrishnoklitinna membranna organela collagen containing extracellular matrixBiologichnij proces gemostaz negative regulation of cell substrate adhesion negative regulation of fibrinolysis negative regulation of cell cell adhesion mediated by cadherin platelet degranulation extracellular matrix disassembly positive regulation of fibrinolysis tissue remodeling negative regulation of cell population proliferation zsidannya krovi proteoliz Fibrinoliz positive regulation of blood vessel endothelial cell migration tissue regeneration myoblast differentiation muscle cell cellular homeostasis proteolysis involved in cellular protein catabolic process trophoblast giant cell differentiation labyrinthine layer blood vessel development mononuclear cell migrationDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez5340 18815Ensembl ENSG00000122194 ENSMUSG00000059481UniProt P00747 P20918RefSeq mRNK NM 001168338NM 000301NM 008877RefSeq bilok NP 000292NP 001161810NP 032903Lokus UCSC Hr 6 160 7 160 75 MbHr 17 12 6 12 64 MbPubMed search 3 4 VikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050MEHKEVVLLLLLFLKSGQGEPLDDYVNTQGASLFSVTKKQLGAGSIEECAAKCEEDEEFTCRAFQYHSKEQQCVIMAENRKSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILECEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRELRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSPVSTEQLAPTAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKTPENYPNAGLTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCSGTEASVVAPPPVVLLPDVETPSEEDCMFGNGKGYRGKRATTVTGTPCQDWAAQEPHRHSIFTPETNPRAGLEKNYCRNPDGDVGGPWCYTTNPRKLYDYCDVPQCAAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVMRNNA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Cej bilok za funkciyami nalezhit do gidrolaz proteaz serinovih proteaz Zadiyanij u takih biologichnih procesah yak zsidannya krovi gemostaz fibrinoliz remodelyuvannya tkanini Sekretovanij nazovni Literatura red Forsgren M Raden B Israelsson M Larsson K Heden L O 1987 Molecular cloning and characterization of a full length cDNA clone for human plasminogen FEBS Lett 213 254 260 PubMed DOI 10 1016 0014 5793 87 81501 6 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PubMed DOI 10 1101 gr 2596504 Wiman B Wallen P 1975 Structural relationship between glutamic acid and lysine forms of human plasminogen and their interaction with the NH2 terminal activation peptide as studied by affinity chromatography Eur J Biochem 50 489 494 PubMed DOI 10 1111 j 1432 1033 1975 tb09887 x Malinowski D P Sadler J E Davie E W 1984 Characterization of a complementary deoxyribonucleic acid coding for human and bovine plasminogen Biochemistry 23 4243 4250 PubMed DOI 10 1021 bi00313a035 Wiman B Wallen P 1975 Amino acid sequence of the cyanogen bromide fragment from human plasminogen that forms the linkage between the plasmin chains Eur J Biochem 58 539 547 PubMed DOI 10 1111 j 1432 1033 1975 tb02403 x Wiman B 1977 Primary structure of the B chain of human plasmin Eur J Biochem 76 129 137 PubMed DOI 10 1111 j 1432 1033 1977 tb11578 xPrimitki red Zahvoryuvannya genetichno pov yazani z Plazminogen pereglyanuti redaguvati posilannya na VikiDanih Spoluki yaki fizichno vzayemodiyut z Plazminogen pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 9071 angl Procitovano 30 sichnya 2017 UniProt P00747 angl Procitovano 30 sichnya 2017 Div takozh red Hromosoma 6 nbsp Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Otrimano z https uk wikipedia org w index php title Plazminogen amp oldid 38242089