www.wikidata.uk-ua.nina.az
Beta lancyug tubulinu angl Tubulin beta class I bilok yakij koduyetsya genom TUBB roztashovanim u lyudej na korotkomu plechi 6 yi hromosomi 5 Dovzhina polipeptidnogo lancyuga bilka stanovit 444 aminokislot a molekulyarna masa 49 671 6 Beta lancyug tubulinuNayavni strukturiPDBPoshuk ortologiv PDBe RCSBSpisok kodiv PDB3QNZ 3QO0IdentifikatoriSimvoliTUBB CDCBM6 M40 OK SW cl 56 TUBB1 TUBB5 CSCSC1 tubulin beta class IZovnishni ID OMIM 191130 MGI 107812 HomoloGene 69099 GeneCards TUBBPov yazani genetichni zahvoryuvannyacomplex cortical dysplasia with other brain malformations 6 1 Reaguye na spolukukabazitaksel Docetaksel eribulin ixabepilone paklitaksel vinkristin velban 2 Ontologiya genaMolekulyarna funkciya GTPase activating protein binding nucleotide binding protein domain specific binding GO 0032403 protein containing complex binding GTP binding structural molecule activity structural constituent of cytoskeleton GO 0001948 GO 0016582 protein binding GO 0006184 GTPase activity MHC class I protein binding ubiquitin protein ligase bindingKlitinna komponenta cell body extracellular region nuclear envelope lumen cytoplasmic ribonucleoprotein granule ekzosoma GO 0005578 Pozaklitinna matricya Mikrotrubochki Citoskelet klitinne yadro microtubule cytoskeleton azurophil granule lumen citoplazma membrane raft GO 0009327 protein containing complexBiologichnij proces cytoskeleton dependent intracellular transport spindle assembly podil klitini G2 M transition of mitotic cell cycle GO 0006928 klitinnij proces natural killer cell mediated cytotoxicity microtubule based process neutrophil degranulation ciliary basal body plasma membrane docking regulation of G2 M transition of mitotic cell cycle microtubule cytoskeleton organization GO 0007067 mitoz GO 1904739 regulation of synapse organization cytoskeleton organizationDzherela Amigo QuickGOOrtologiVidi Lyudina MishaEntrez203068 22154Ensembl ENSG00000196230ENSG00000232421ENSG00000183311ENSG00000224156ENSG00000235067ENSG00000232575ENSG00000227739ENSG00000229684 ENSMUSG00000001525UniProt P07437Q5SU16 P99024RefSeq mRNK NM 001293212NM 001293213NM 001293214NM 001293215NM 001293216NM 178014NM 011655RefSeq bilok NP 001280141NP 001280142NP 001280143NP 001280144NP 001280145NP 821133NP 821133 1NP 035785Lokus UCSC Hr 6 30 72 30 73 MbHr 17 36 14 36 15 MbPubMed search 3 4 VikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQVFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEEDFGEEAEEEAA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Bilok maye sajt dlya zv yazuvannya z nukleotidami GTF Lokalizovanij u citoplazmi citoskeleti Literatura red Lee M G S Lewis S A Wilde C D Cowan N J 1983 Evolutionary history of a multigene family an expressed human beta tubulin gene and three processed pseudogenes Cell 33 477 487 PubMed DOI 10 1016 0092 8674 83 90429 4 Hall J L Dudley L Dobner P R Lewis S A Cowan N J 1983 Identification of two human beta tubulin isotypes Mol Cell Biol 3 854 862 PubMed DOI 10 1128 MCB 3 5 854 Crabtree D V Ojima I Geng X Adler A J 2001 Tubulins in the primate retina evidence that xanthophylls may be endogenous ligands for the paclitaxel binding site Bioorg Med Chem 9 1967 1976 PubMed DOI 10 1016 S0968 0896 01 00103 1 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PubMed DOI 10 1101 gr 2596504 Li D Dammer E B Lucki N C Sewer M B 2013 cAMP stimulated phosphorylation of diaphanous 1 regulates protein stability and interaction with binding partners in adrenocortical cells Mol Biol Cell 24 848 857 PubMed DOI 10 1091 mbc E12 08 0597 Valenstein M L Roll Mecak A 2016 Graded control of microtubule severing by tubulin glutamylation Cell 164 911 921 PubMed DOI 10 1016 j cell 2016 01 019Primitki red Zahvoryuvannya genetichno pov yazani z Beta lancyug tubulinu pereglyanuti redaguvati posilannya na VikiDanih Spoluki yaki fizichno vzayemodiyut z Tubulin beta class I pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 20778 angl Arhiv originalu za 28 travnya 2017 Procitovano 30 sichnya 2017 UniProt P07437 angl Arhiv originalu za 26 grudnya 2016 Procitovano 30 sichnya 2017 Div takozh red Hromosoma 6 nbsp Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Otrimano z https uk wikipedia org w index php title Beta lancyug tubulinu amp oldid 35967384