STK11 angl Serine threonine kinase 11 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 19 yi hromosomi 4 Dovzhina polipeptidnogo lancyuga bilka stanovit 433 aminokislot a molekulyarna masa 48 636 5 STK11Nayavni strukturiPDBPoshuk ortologiv PDBe RCSBSpisok kodiv PDB2WTK 4ZDRIdentifikatoriSimvoliSTK11 LKB1 PJS hLKB1 serine threonine kinase 11Zovnishni ID OMIM 602216 MGI 1341870 HomoloGene 393 GeneCards STK11Pov yazani genetichni zahvoryuvannyahvoroba Alcgejmera adenocarcinoma of the lung 1 Ontologiya genaMolekulyarna funkciya transferase activity nucleotide binding LRR domain binding protein kinase activity p53 binding protein kinase activator activity zv yazuvannya z ionom metalu kinase activity protein serine threonine kinase activity GO 0001948 GO 0016582 protein binding ATP binding magnesium ion bindingKlitinna komponenta citoplazma membrana mitohondriya ekzosoma TCR signalosome klitinne yadro Nukleoplazma gialoplazmaBiologichnij proces response to ionizing radiation positive regulation of transforming growth factor beta receptor signaling pathway dendrite extension TCR signalosome assembly axonogenesis glucose homeostasis positive regulation of autophagy fosforilyuvannya negative regulation of lipid biosynthetic process positive regulation of axonogenesis cellular response to DNA damage stimulus regulation of dendrite morphogenesis Avtofagiya protein phosphorylation Golgi localization regulation of Wnt signaling pathway vasculature development anoikis cellular response to UV B negative regulation of cell growth regulation of cell growth tissue homeostasis establishment of cell polarity positive thymic T cell selection positive regulation of peptidyl tyrosine phosphorylation regulation of protein kinase B signaling canonical Wnt signaling pathway intrinsic apoptotic signaling pathway by p53 class mediator protein autophosphorylation klitinnij cikl negative regulation of epithelial cell proliferation involved in prostate gland development T cell receptor signaling pathway Spermatogenez activation of protein kinase activity negative regulation of TORC1 signaling negative regulation of cell population proliferation positive regulation of protein localization to nucleus GO 0097285 Apoptoz regulation of signal transduction by p53 class mediator nejrobiologiya rozvitku GO 0035404 peptidyl serine phosphorylation peptidyl threonine phosphorylation Diferenciaciya klitin positive regulation of protein serine threonine kinase activity GO 0016576 protein dephosphorylation negative regulation of canonical Wnt signaling pathway negative regulation of cold induced thermogenesisDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez6794 20869Ensembl ENSG00000118046 ENSMUSG00000003068UniProt Q15831 Q9WTK7RefSeq mRNK NM 000455NM 001301853NM 001301854NM 011492RefSeq bilok NP 000446NP 001288782NP 001288783NP 035622Lokus UCSC Hr 19 1 18 1 23 MbHr 10 79 95 79 97 MbPubMed search 2 3 VikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050MEVVDPQQLGMFTEGELMSVGMDTFIHRIDSTEVIYQPRRKRAKLIGKYLMGDLLGEGSYGKVKEVLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNEEKQKMYMVMEYCVCGMQEMLDSVPEKRFPVCQAHGYFCQLIDGLEYLHSQGIVHKDIKPGNLLLTTGGTLKISDLGVAEALHPFAADDTCRTSQGSPAFQPPEIANGLDTFSGFKVDIWSAGVTLYNITTGLYPFEGDNIYKLFENIGKGSYAIPGDCGPPLSDLLKGMLEYEPAKRFSIRQIRQHSWFRKKHPPAEAPVPIPPSPDTKDRWRSMTVVPYLEDLHGADEDEDLFDIEDDIIYTQDFTVPGQVPEEEASHNGQRRGLPKAVCMNGTEAAQLSTKSRAEGRAPNPARKACSASSKIRRLSACKQQA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do transferaz kinaz serin treoninovih proteyinkinaz fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak apoptoz klitinnij cikl poshkodzhennya DNK avtofagiya diferenciaciya klitin spermatogenez acetilyuvannya alternativnij splajsing Bilok maye sajt dlya zv yazuvannya z ATF nukleotidami ionami metaliv ionom magniyu ionom margancyu Lokalizovanij u citoplazmi yadri membrani mitohondriyi Literatura red The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PubMed DOI 10 1101 gr 2596504 Carretero J Medina P P Pio R Montuenga L M Sanchez Cespedes M 2004 Novel and natural knockout lung cancer cell lines for the LKB1 STK11 tumor suppressor gene Oncogene 23 4037 4040 PubMed DOI 10 1038 sj onc 1207502 Zeng P Y Berger S L 2006 LKB1 is recruited to the p21 WAF1 promoter by p53 to mediate transcriptional activation Cancer Res 66 10701 10708 PubMed DOI 10 1158 0008 5472 CAN 06 0999 Xie X Wang Z Chen Y 2007 Association of LKB1 with a WD repeat protein WDR6 is implicated in cell growth arrest and p27 Kip1 induction Mol Cell Biochem 301 115 122 PubMed DOI 10 1007 s11010 006 9402 5 Lan F Cacicedo J M Ruderman N Ido Y 2008 SIRT1 modulation of the acetylation status cytosolic localization and activity of LKB1 Possible role in AMP activated protein kinase activation J Biol Chem 283 27628 27635 PubMed DOI 10 1074 jbc M805711200 Denison F C Hiscock N J Carling D Woods A 2009 Characterization of an alternative splice variant of LKB1 J Biol Chem 284 67 76 PubMed DOI 10 1074 jbc M806153200Primitki red Zahvoryuvannya genetichno pov yazani z STK11 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 11389 angl Procitovano 12 veresnya 2017 UniProt Q15831 angl Arhiv originalu za 1 veresnya 2017 Procitovano 12 veresnya 2017 Div takozh red Hromosoma 19 nbsp Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Otrimano z https uk wikipedia org w index php title STK11 amp oldid 35724537
