KRAS angl KRAS proto oncogene GTPase bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 12 yi hromosomi 5 Dovzhina polipeptidnogo lancyuga bilka stanovit 189 aminokislot a molekulyarna masa 21 656 6 KRASNayavni strukturiPDBPoshuk ortologiv PDBe RCSBSpisok kodiv PDB4WA7 1D8D 1D8E 3GFT 4DSN 4DSO 4EPR 4EPT 4EPV 4EPW 4EPX 4EPY 4L8G 4LDJ 4LPK 4LRW 4LUC 4LV6 4LYF 4LYH 4LYJ 4M1O 4M1S 4M1T 4M1W 4M1Y 4M21 4M22 4NMM 4OBE 4PZY 4PZZ 4Q01 4Q02 4Q03 4QL3 4TQ9 4TQA 4DST 4DSU 5F2E s2MSC 2MSD 2MSEIdentifikatoriSimvoliKRAS C K RAS CFC2 K RAS2A K RAS2B K RAS4A K RAS4B KI RAS KRAS1 KRAS2 NS NS3 RALD RASK2 K ras KRAS proto oncogene GTPase c Ki ras2 OES c Ki ras K Ras 2 C K RAS K Ras Kirsten RAt Sarcoma virus Kirsten Rat Sarcoma virusZovnishni ID OMIM 190070 MGI 96680 HomoloGene 37990 GeneCards KRASPov yazani genetichni zahvoryuvannyagostrij miyeloyidnij lejkoz juvenile myelomonocytic leukemia Noonan syndrome 3 large intestine adenocarcinoma adenocarcinoma of the lung nedribnoklitinna karcinoma legeniv 1 Reaguye na spolukulonafarnib 2 Ontologiya genaMolekulyarna funkciya nucleotide binding LRR domain binding GDP binding GO 0032403 protein containing complex binding GTP binding GMP binding GO 0001948 GO 0016582 protein binding GO 0006184 GTPase activity identical protein bindingKlitinna komponenta citoplazma gialoplazma membrana focal adhesion extrinsic component of cytoplasmic side of plasma membrane klitinna membrana mitohondriya membrane raftBiologichnij proces visual learning GO 1904089 negative regulation of neuron apoptotic process response to mineralocorticoid positive regulation of protein phosphorylation regulation of long term neuronal synaptic plasticity regulation of protein stability epidermal growth factor receptor signaling pathway positive regulation of MAP kinase activity cytokine mediated signaling pathway negative regulation of cell differentiation stimulatory C type lectin receptor signaling pathway response to glucocorticoid MAPK cascade axon guidance Fc epsilon receptor signaling pathway positive regulation of nitric oxide synthase activity forebrain astrocyte development endocrine signaling positive regulation of NF kappaB transcription factor activity homeostasis of number of cells within a tissue striated muscle cell differentiation Ras protein signal transduction epithelial tube branching involved in lung morphogenesis regulation of synaptic transmission GABAergic actin cytoskeleton organization leukocyte migration GO 0072468 Signalna transdukciya positive regulation of Rac protein signal transduction GO 1901313 positive regulation of gene expression positive regulation of cell population proliferation ERBB2 signaling pathway liver development positive regulation of cellular senescence female pregnancy response to isolation stressDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez3845 16653Ensembl ENSG00000133703 ENSMUSG00000030265UniProt P01116 P32883RefSeq mRNK NM 004985NM 033360NM 001369786NM 001369787NM 021284RefSeq bilok NP 004976NP 203524NP 001356715NP 001356716NP 004976 2NP 067259NP 001390169NP 001390170NP 001390171NP 001390172NP 001390173NP 001390174NP 001390175Lokus UCSC Hr 12 25 21 25 25 MbHr 6 145 16 145 2 MbPubMed search 3 4 VikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKKCIIMA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin Y Tirozin Zadiyanij u takih biologichnih procesah yak acetilyuvannya alternativnij splajsing Bilok maye sajt dlya zv yazuvannya z nukleotidami GTF Lokalizovanij u klitinnij membrani citoplazmi membrani Literatura RedaguvatiMcCoy M S Bargmann C I Weinberg R A 1984 Human colon carcinoma Ki ras2 oncogene and its corresponding proto oncogene Mol Cell Biol 4 1577 1582 PubMed DOI 10 1128 MCB 4 8 1577 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PubMed DOI 10 1101 gr 2596504 Yamamoto F Perucho M 1984 Activation of a human c K ras oncogene Nucleic Acids Res 12 8873 8885 PubMed DOI 10 1093 nar 12 23 8873 Serra R W Fang M Park S M Hutchinson L Green M R 2014 A KRAS directed transcriptional silencing pathway that mediates the CpG island methylator phenotype Elife 3 E02313 E02313 PubMed DOI 10 7554 eLife 02313 Grimmond S M Raghavan D Russell P J 1992 Detection of a rare point mutation in Ki ras of a human bladder cancer xenograft by polymerase chain reaction and direct sequencing Urol Res 20 121 126 PubMed DOI 10 1007 BF00296523 Sharma M K Zehnbauer B A Watson M A Gutmann D H 2005 RAS pathway activation and an oncogenic RAS mutation in sporadic pilocytic astrocytoma Neurology 65 1335 1336 PubMed DOI 10 1212 01 wnl 0000180409 78098 d7Primitki Redaguvati Zahvoryuvannya genetichno pov yazani z KRAS pereglyanuti redaguvati posilannya na VikiDanih Spoluki yaki fizichno vzayemodiyut z KRAS proto oncogene GTPase pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 6407 angl Arhiv originalu za 11 veresnya 2015 Procitovano 11 veresnya 2017 UniProt P01116 angl Arhiv originalu za 17 veresnya 2017 Procitovano 11 veresnya 2017 Div takozh RedaguvatiHromosoma 12 nbsp Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Otrimano z https uk wikipedia org w index php title KRAS amp oldid 35513910
