SUMO1 angl Small ubiquitin like modifier 1 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 2 yi hromosomi 3 Dovzhina polipeptidnogo lancyuga bilka stanovit 101 aminokislot a molekulyarna masa 11 557 4 SUMO1Nayavni strukturiPDBPoshuk ortologiv PDBe RCSBSpisok kodiv PDB4WJQ 1A5R 1TGZ 1WYW 1Y8R 1Z5S 2ASQ 2BF8 2G4D 2IO2 2IY0 2IY1 2KQS 2LAS 2MW5 2PE6 2UYZ 2VRR 3KYC 3KYD 3RZW 3UIP 4WJN 4WJO 4WJP 5AEK 2N1V 2N1AIdentifikatoriSimvoliSUMO1 DAP1 GMP1 OFC10 PIC1 SENP2 SMT3 SMT3C SMT3H3 UBL1 small ubiquitin like modifier 1 small ubiquitin like modifier 1Zovnishni ID OMIM 601912 MGI 1197010 HomoloGene 2514 GeneCards SUMO1Ontologiya genaMolekulyarna funkciya transcription factor binding potassium channel regulator activity GO 0001948 GO 0016582 protein binding protein tag ubiquitin protein ligase binding RNA binding transcription corepressor binding protein C terminus binding SUMO transferase activity enzyme binding protein macromolecule adaptor activity glucocorticoid receptor binding small protein activating enzyme binding ubiquitin like protein ligase bindingKlitinna komponenta citoplazma PML body nuclear speck Yaderni tilcya Yaderna membrana membrana voltage gated potassium channel complex klitinna membrana sinaps Yaderna pora Nukleoplazma GO 0035328 Geterohromatin XY body Dendrit nejrobiologiya Yaderce fibrillar center klitinne yadro nuclear stress granule SUMO activating enzyme complex nuclear envelope gialoplazmaBiologichnij proces roof of mouth development GO 0009373 regulation of transcription DNA templated regulation of protein stability positive regulation of protein containing complex assembly protein localization to nuclear pore protein stabilization negative regulation of action potential negative regulation of DNA binding transcription factor activity regulation of protein localization regulation of cardiac muscle cell contraction global genome nucleotide excision repair PML body organization regulation of interferon gamma mediated signaling pathway GO 0022415 viral process GO 0045996 negative regulation of transcription DNA templated double strand break repair via nonhomologous end joining regulation of calcium ion transmembrane transport positive regulation of proteasomal ubiquitin dependent protein catabolic process negative regulation of delayed rectifier potassium channel activity positive regulation of ATPase coupled calcium transmembrane transporter activity GO 0100026 Reparaciya DNK GO 1901227 negative regulation of transcription by RNA polymerase II cellular response to heat cellular response to cadmium ion protein sumoylation negative regulation of DNA bindingDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez7341 22218Ensembl ENSG00000116030 ENSMUSG00000026021UniProt P63165 P63166RefSeq mRNK NM 003352NM 001005781NM 001005782NM 009460RefSeq bilok NP 001005781NP 001005782NP 003343NP 001358321NP 001358322NP 001358323NP 033486Lokus UCSC Hr 2 202 21 202 24 MbHr 1 59 63 59 71 MbPubMed search 1 2 VikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTVA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak vzayemodiya hazyayin virus ubikvitinuvannya bilkiv acetilyaciya alternativnij splajsing Lokalizovanij u klitinnij membrani citoplazmi yadri membrani Literatura RedaguvatiShen Z Pardington Purtymun P E Comeaux J C Moyzis R K Chen D J 1996 UBL1 a human ubiquitin like protein associating with human RAD51 RAD52 proteins Genomics 36 271 279 PubMed DOI 10 1006 geno 1996 0462 Mahajan R Delphin C Guan T Gerace L Melchior F 1997 A small ubiquitin related polypeptide involved in targeting RanGAP1 to nuclear pore complex protein RanBP2 Cell 88 97 107 PubMed DOI 10 1016 S0092 8674 00 81862 0 Matunis M J Coutavas E Blobel G 1996 A novel ubiquitin like modification modulates the partitioning of the Ran GTPase activating protein RanGAP1 between the cytosol and the nuclear pore complex J Cell Biol 135 1457 1470 PubMed DOI 10 1083 jcb 135 6 1457 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PubMed DOI 10 1101 gr 2596504 Kamitani T Nguyen H P Yeh E T H 1997 Preferential modification of nuclear proteins by a novel ubiquitin like molecule J Biol Chem 272 14001 14004 PubMed DOI 10 1074 jbc 272 22 14001 Minty A Dumont X Kaghad M Caput D 2000 Covalent modification of p73alpha by SUMO 1 Two hybrid screening with p73 identifies novel SUMO 1 interacting proteins and a SUMO 1 interaction motif J Biol Chem 275 36316 36323 PubMed DOI 10 1074 jbc M004293200Primitki Redaguvati Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 12502 angl Procitovano 28 serpnya 2017 UniProt P63165 angl Arhiv originalu za 27 serpnya 2017 Procitovano 28 serpnya 2017 Div takozh RedaguvatiHromosoma 2 nbsp Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Otrimano z https uk wikipedia org w index php title SUMO1 amp oldid 35725737
