www.wikidata.uk-ua.nina.az

S100B англ S100 calcium binding protein B білок який кодується однойменним геном розташованим у людей на короткому плечі

S100B

S100B (англ. S100 calcium binding protein B) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 21-ї хромосоми. Довжина поліпептидного ланцюга білка становить 92 амінокислот, а молекулярна маса — 10 713.

S100B
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи S100B, NEF, S100, S100-B, S100beta, S100 calcium binding protein B
Зовнішні ІД OMIM: 176990 MGI: 98217 HomoloGene: 4567 GeneCards: S100B
Шаблон експресії
Більше даних
Ортологи
Види Людина Миша
Entrez
6285
20203
Ensembl
UniProt
RefSeq (мРНК)
RefSeq (білок)
Локус (UCSC) Хр. 21: 46.6 – 46.61 Mb Хр. 10: 76.09 – 76.1 Mb
PubMed search
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKE
QEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE

Задіяний у такому біологічному процесі, як ацетилювання. Білок має сайт для зв'язування з іонами металів, іоном цинку, іоном кальцію. Локалізований у цитоплазмі, ядрі.

Література ред.

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Jensen R., Marshak D.R., Anderson C., Lukas T.J., Watterson D.M. (1985). Characterization of human brain S100 protein fraction: amino acid sequence of S100 beta.. J. Neurochem. 45: 700 — 705.  PubMed DOI:10.1111/j.1471-4159.1985.tb04048.x
  • Baudier J., Glasser N., Haglid K., Gerard D. (1984). Purification, characterization and ion binding properties of human brain S100b protein.. Biochim. Biophys. Acta 790: 164 — 173.  PubMed DOI:10.1016/0167-4838(84)90220-6
  • Yang Q., O'Hanlon D., Heizmann C.W., Marks A. (1999). Demonstration of heterodimer formation between S100B and S100A6 in the yeast two-hybrid system and human melanoma.. Exp. Cell Res. 246: 501 — 509.  PubMed DOI:10.1006/excr.1998.4314
  • Park H., Adsit F.G., Boyington J.C. (2010). The 1.5 A crystal structure of human receptor for advanced glycation endproducts (RAGE) ectodomains reveals unique features determining ligand binding.. J. Biol. Chem. 285: 40762 — 40770.  PubMed DOI:10.1074/jbc.M110.169276
  • Smith S.P., Shaw G.S. (1998). A novel calcium-sensitive switch revealed by the structure of human S100B in the calcium-bound form.. Structure 6: 211 — 222.  PubMed DOI:10.1016/S0969-2126(98)00022-7

Примітки ред.

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:10500 (англ.). Процитовано 12 вересня 2017. 
  4. (англ.). Архів оригіналу за 25 серпня 2017. Процитовано 12 вересня 2017. 

Див. також ред.


Це незавершена стаття про білки.
Ви можете допомогти проєкту, виправивши або дописавши її.
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри
Дата публікації:
S100B angl S100 calcium binding protein B bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 21 yi hromosomi 3 Dovzhina polipeptidnogo lancyuga bilka stanovit 92 aminokislot a molekulyarna masa 10 713 4 S100BNayavni strukturiPDBPoshuk ortologiv PDBe RCSBSpisok kodiv PDB1MQ1 1UWO 2H61 2M49 2PRU 3CZT 3D0Y 3D10 3HCM 4XYN 5CSJ 5CSF 5CSN 5CSIIdentifikatoriSimvoliS100B NEF S100 S100 B S100beta S100 calcium binding protein BZovnishni ID OMIM 176990 MGI 98217 HomoloGene 4567 GeneCards S100BOntologiya genaMolekulyarna funkciya calcium ion binding S100 protein binding protein homodimerization activity zinc ion binding zv yazuvannya z ionom metalu calcium dependent protein binding GO 0001948 GO 0016582 protein binding identical protein binding tau protein binding signaling receptor binding RAGE receptor bindingKlitinna komponenta citoplazma ruffle extracellular region neuronal cell body perinuclear region of cytoplasm klitinne yadro extracellular spaceBiologichnij proces axonogenesis response to glucocorticoid pam yat negative regulation of skeletal muscle cell differentiation central nervous system development astrocyte differentiation positive regulation of synaptic transmission positive regulation of cell population proliferation regulation of cell shape positive regulation of apoptotic process learning or memory positive regulation of I kappaB kinase NF kappaB signaling regulation of neuronal synaptic plasticity response to methylmercury proliferaciya Vrodzhenij imunitet cellular response to hypoxia Dovgotrivala potenciaciya positive regulation of myelinationDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez6285 20203Ensembl ENSG00000160307 ENSMUSG00000033208UniProt P04271 P50114RefSeq mRNK NM 006272NM 009115RefSeq bilok NP 006263NP 033141Lokus UCSC Hr 21 46 6 46 61 MbHr 10 76 09 76 1 MbPubMed search 1 2 VikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHEA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin Q Glutamin R Arginin S Serin T Treonin V Valin Y Tirozin Zadiyanij u takomu biologichnomu procesi yak acetilyuvannya Bilok maye sajt dlya zv yazuvannya z ionami metaliv ionom cinku ionom kalciyu Lokalizovanij u citoplazmi yadri Literatura red The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PubMed DOI 10 1101 gr 2596504 Jensen R Marshak D R Anderson C Lukas T J Watterson D M 1985 Characterization of human brain S100 protein fraction amino acid sequence of S100 beta J Neurochem 45 700 705 PubMed DOI 10 1111 j 1471 4159 1985 tb04048 x Baudier J Glasser N Haglid K Gerard D 1984 Purification characterization and ion binding properties of human brain S100b protein Biochim Biophys Acta 790 164 173 PubMed DOI 10 1016 0167 4838 84 90220 6 Yang Q O Hanlon D Heizmann C W Marks A 1999 Demonstration of heterodimer formation between S100B and S100A6 in the yeast two hybrid system and human melanoma Exp Cell Res 246 501 509 PubMed DOI 10 1006 excr 1998 4314 Park H Adsit F G Boyington J C 2010 The 1 5 A crystal structure of human receptor for advanced glycation endproducts RAGE ectodomains reveals unique features determining ligand binding J Biol Chem 285 40762 40770 PubMed DOI 10 1074 jbc M110 169276 Smith S P Shaw G S 1998 A novel calcium sensitive switch revealed by the structure of human S100B in the calcium bound form Structure 6 211 222 PubMed DOI 10 1016 S0969 2126 98 00022 7Primitki red Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 10500 angl Procitovano 12 veresnya 2017 UniProt P04271 angl Arhiv originalu za 25 serpnya 2017 Procitovano 12 veresnya 2017 Div takozh red Hromosoma 21 nbsp Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Otrimano z https uk wikipedia org w index php title S100B amp oldid 38132955