www.wikidata.uk-ua.nina.az
PFN2 angl Profilin 2 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 3 yi hromosomi 3 Dovzhina polipeptidnogo lancyuga bilka stanovit 140 aminokislot a molekulyarna masa 15 046 4 PFN2Nayavni strukturiPDBPoshuk ortologiv PDBe RCSBSpisok kodiv PDB1D1JIdentifikatoriSimvoliPFN2 D3S1319E PFL profilin 2Zovnishni ID OMIM 176590 MGI 97550 HomoloGene 1974 GeneCards PFN2Ontologiya genaMolekulyarna funkciya actin binding phosphatidylinositol 4 5 bisphosphate binding actin monomer binding GO 0001948 GO 0016582 protein binding ATPase activityKlitinna komponenta citoplazma terminal bouton ekzosoma Citoskelet Schaffer collateral CA1 synapse presynapse postsynapse glutamatergic synapseBiologichnij proces regulation of actin filament polymerization regulation of synaptic vesicle exocytosis protein stabilization positive regulation of actin filament bundle assembly positive regulation of actin filament polymerization negative regulation of actin filament polymerization positive regulation of ATP dependent activity negative regulation of epithelial cell migration positive regulation of stress fiber assembly actin cytoskeleton organization positive regulation of peptidyl serine phosphorylation negative regulation of ruffle assembly modification of postsynaptic actin cytoskeletonDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez5217 18645Ensembl ENSG00000070087 ENSMUSG00000027805UniProt P35080 Q9JJV2RefSeq mRNK NM 053024NM 002628NM 019410RefSeq bilok NP 002619NP 444252NP 062283Lokus UCSC Hr 3 149 96 150 05 Mbn dPubMed search 1 2 VikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFFTNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGFA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Zadiyanij u takih biologichnih procesah yak acetilyaciya alternativnij splajsing Bilok maye sajt dlya zv yazuvannya z molekuloyu aktinu Lokalizovanij u citoplazmi citoskeleti Literatura red Honore B Madsen P S Andersen A H Leffers H 1993 Cloning and expression of a novel human profilin variant profilin II FEBS Lett 330 151 155 PubMed DOI 10 1016 0014 5793 93 80262 S The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PubMed DOI 10 1101 gr 2596504 Gieselmann R Kwiatkowski D J Janmey P A Witke W 1995 Distinct biochemical characteristics of the two human profilin isoforms Eur J Biochem 229 621 628 PubMed DOI 10 1111 j 1432 1033 1995 tb20506 x Nodelman I M Bowman G D Lindberg U Schutt C E 1999 X ray structure determination of human profilin II a comparative structural analysis of human profilins J Mol Biol 294 1271 1285 PubMed DOI 10 1006 jmbi 1999 3318Primitki red Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 8882 angl Procitovano 30 serpnya 2017 UniProt P35080 angl Arhiv originalu za 11 zhovtnya 2016 Procitovano 30 serpnya 2017 Div takozh red Hromosoma 3 nbsp Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Otrimano z https uk wikipedia org w index php title PFN2 amp oldid 38242185