www.wikidata.uk-ua.nina.az
P2RX5 angl Purinergic receptor P2X 5 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 17 yi hromosomi 3 Dovzhina polipeptidnogo lancyuga bilka stanovit 422 aminokislot a molekulyarna masa 47 205 4 P2RX5IdentifikatoriSimvoliP2RX5 LRH 1 P2X5 P2X5R purinergic receptor P2X 5Zovnishni ID OMIM 602836 MGI 2137026 HomoloGene 1924 GeneCards P2RX5Ontologiya genaMolekulyarna funkciya ion channel activity ATP binding transmembrane signaling receptor activity purinergic nucleotide receptor activity extracellularly ATP gated cation channel activity ATP gated ion channel activityKlitinna komponenta integral component of membrane integral component of nuclear inner membrane integral component of plasma membrane membrana klitinna membrana gialoplazma postsynapseBiologichnij proces response to ATP positive regulation of calcium mediated signaling ion transport positive regulation of calcium ion transport into cytosol cation transmembrane transport GO 0072468 Signalna transdukciya nejrobiologiya rozvitku zsidannya krovi purinergic nucleotide receptor signaling pathway excitatory postsynaptic potential cation transport ion transmembrane transportDzherela Amigo QuickGOOrtologiVidi Lyudina MishaEntrez5026 94045Ensembl ENSG00000083454 ENSMUSG00000005950UniProt Q93086 n dRefSeq mRNK NM 175081NM 001204519NM 001204520NM 002561NM 175080NM 033321NM 001376982NM 001376983RefSeq bilok NP 001191448NP 001191449NP 002552NP 778255n dLokus UCSC Hr 17 3 67 3 7 MbHr 11 73 05 73 06 MbPubMed search 1 2 VikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050MGQAGCKGLCLSLFDYKTEKYVIAKNKKVGLLYRLLQASILAYLVVWVFLIKKGYQDVDTSLQSAVITKVKGVAFTNTSDLGQRIWDVADYVIPAQGENVFFVVTNLIVTPNQRQNVCAENEGIPDGACSKDSDCHAGEAVTAGNGVKTGRCLRRENLARGTCEIFAWCPLETSSRPEEPFLKEAEDFTIFIKNHIRFPKFNFSKSNVMDVKDRSFLKSCHFGPKNHYCPIFRLGSVIRWAGSDFQDIALEGGVIGINIEWNCDLDKAASECHPHYSFSRLDNKLSKSVSSGYNFRFARYYRDAAGVEFRTLMKAYGIRFDVMVNGKGAFFCDLVLIYLIKKREFYRDKKYEEVRGLEDSSQEAEDEASGLGLSEQLTSGPGLLGMPEQQELQEPPEAKRGSSSQKGNGSVCPQLLEPHRSTA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do receptoriv ionnih kanaliv Zadiyanij u takih biologichnih procesah yak transport ioniv transport alternativnij splajsing Lokalizovanij u membrani Literatura red Le K T Paquet M Nouel D Babinski K Seguela P 1997 Primary structure and expression of a naturally truncated human P2X ATP receptor subunit from brain and immune system FEBS Lett 418 195 199 PubMed DOI 10 1016 S0014 5793 97 01380 X The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PubMed DOI 10 1101 gr 2596504Primitki red Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 8536 angl Procitovano 12 veresnya 2017 UniProt Q93086 angl Arhiv originalu za 14 listopada 2016 Procitovano 12 veresnya 2017 Div takozh red Hromosoma 17 nbsp Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Otrimano z https uk wikipedia org w index php title P2RX5 amp oldid 36630944