P2RX4 angl Purinergic receptor P2X 4 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 12 yi hromosomi 4 Dovzhina polipeptidnogo lancyuga bilka stanovit 388 aminokislot a molekulyarna masa 43 369 5 P2RX4IdentifikatoriSimvoliP2RX4 P2X4 P2X4R purinergic receptor P2X 4Zovnishni ID OMIM 600846 MGI 1338859 HomoloGene 1923 GeneCards P2RX4Reaguye na spolukuAdenozintrifosfat 1 Ontologiya genaMolekulyarna funkciya protein homodimerization activity zinc ion binding cadherin binding purinergic nucleotide receptor activity extracellularly ATP gated cation channel activity ion channel activity GO 0001948 GO 0016582 protein binding copper ion binding signaling receptor binding ATP binding identical protein bindingKlitinna komponenta integral component of membrane membrana GO 0097483 GO 0097481 Postsinaptichne ushilnennya dendritic spine integral component of nuclear inner membrane sinaps integral component of plasma membrane lysosomal membrane Mizhklitinni kontakti neuronal cell body terminal bouton akson dendrit nejrobiologiya perinuclear region of cytoplasm ekzosoma klitinna membrana postsynapseBiologichnij proces response to ATP positive regulation of calcium mediated signaling positive regulation of calcium ion transport into cytosol negative regulation of cardiac muscle hypertrophy regulation of sodium ion transport positive regulation of nitric oxide biosynthetic process membrane depolarization endothelial cell activation ion transport cation transmembrane transport response to fluid shear stress regulation of blood pressure ion transmembrane transport positive regulation of prostaglandin secretion tissue homeostasis apoptotic signaling pathway sensory perception of pain regulation of cardiac muscle contraction cellular response to ATP protein homooligomerization relaxation of cardiac muscle GO 0072468 Signalna transdukciya neuronal action potential purinergic nucleotide receptor signaling pathway positive regulation of calcium ion transport zsidannya krovi excitatory postsynaptic potential positive regulation of blood vessel endothelial cell migration positive regulation of endothelial cell chemotaxis GO 0015915 transportDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez5025 18438Ensembl ENSG00000135124 ENSMUSG00000029470UniProt Q99571 Q9JJX6RefSeq mRNK NM 001256796NM 001261397NM 001261398NM 002560NM 175567NM 175568NM 011026NM 001310718NM 001310720RefSeq bilok NP 001243725NP 001248326NP 001248327NP 002551n dLokus UCSC Hr 12 121 21 121 23 MbHr 5 122 85 122 87 MbPubMed search 2 3 VikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050MAGCCAALAAFLFEYDTPRIVLIRSRKVGLMNRAVQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKVKGVAVTNTSKLGFRIWDVADYVIPAQEENSLFVMTNVILTMNQTQGLCPEIPDATTVCKSDASCTAGSAGTHSNGVSTGRCVAFNGSVKTCEVAAWCPVEDDTHVPQPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTTYLKSCIYDAKTDPFCPIFRLGKIVENAGHSFQDMAVEGGIMGIQVNWDCNLDRAASLCLPRYSFRRLDTRDVEHNVSPGYNFRFAKYYRDLAGNEQRTLIKAYGIRFDIIVFGKAGKFDIIPTMINIGSGLALLGMATVLCDIIVLYCMKKRLYYREKKYKYVEDYEQGLASELDQA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do receptoriv ionnih kanaliv Zadiyanij u takih biologichnih procesah yak transport ioniv transport alternativnij splajsing Lokalizovanij u membrani Literatura red The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PubMed DOI 10 1101 gr 2596504 Garcia Guzman M Soto F Gomez Hernandez J M Lund P E Stuhmer W 1997 Characterization of recombinant human P2X4 receptor reveals pharmacological differences to the rat homologue Mol Pharmacol 51 109 118 PubMedPrimitki red Spoluki yaki fizichno vzayemodiyut z Purinergic receptor P2X 4 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 8535 angl Procitovano 11 veresnya 2017 UniProt Q99571 angl Arhiv originalu za 25 veresnya 2017 Procitovano 11 veresnya 2017 Div takozh red Hromosoma 12 nbsp Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Otrimano z https uk wikipedia org w index php title P2RX4 amp oldid 36630946
