www.wikidata.uk-ua.nina.az
MMP14 angl Matrix metallopeptidase 14 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 14 yi hromosomi 4 Dovzhina polipeptidnogo lancyuga bilka stanovit 582 aminokislot a molekulyarna masa 65 894 5 MMP14Nayavni strukturiPDBPoshuk ortologiv PDBe RCSBSpisok kodiv PDB1BQQ 1BUV 2MQS 3C7X 3MA2 4P3C 4P3D 4QXU 3X23IdentifikatoriSimvoliMMP14 MMP 14 MMP X1 MT MMP MT MMP 1 MT1 MMP MT1MMP MTMMP1 WNCHRS matrix metallopeptidase 14Zovnishni ID OMIM 600754 MGI 101900 HomoloGene 21040 GeneCards MMP14Reaguye na spolukucts 1027 1 Ontologiya genaMolekulyarna funkciya zinc ion binding zv yazuvannya z ionom metalu integrin binding GO 0070122 peptidase activity GO 0001948 GO 0016582 protein binding metalloendopeptidase activity peptidase activator activity metallopeptidase activity hydrolase activity serine type endopeptidase activity metalloaminopeptidase activity endopeptidase activityKlitinna komponenta citoplazma integral component of membrane membrana focal adhesion GO 0005578 Pozaklitinna matricya Melanosoma klitinna membrana integral component of plasma membrane macropinosome Golgi lumen GO 0016023 cytoplasmic vesicle extracellular space klitinne yadro gialoplazma intermediate filament cytoskeletonBiologichnij proces positive regulation of myotube differentiation male gonad development response to hypoxia endodermal cell differentiation GO 1904578 response to organic cyclic compound Osifikaciya lung development astrocyte cell migration positive regulation of cell migration positive regulation of B cell differentiation zymogen activation response to mechanical stimulus extracellular matrix disassembly endochondral ossification GO 0001306 response to oxidative stress craniofacial suture morphogenesis proteoliz positive regulation of peptidase activity response to estrogen positive regulation of cell growth endothelial cell proliferation chondrocyte proliferation Angiogenez collagen catabolic process ovarian follicle development embryonic cranial skeleton morphogenesis response to hormone tissue remodeling bone development branching morphogenesis of an epithelial tube negative regulation of focal adhesion assembly cell migration negative regulation of Notch signaling pathway protein processing cell motility positive regulation of macrophage migration response to odorant positive regulation of protein processing head development regulation of protein localization to plasma membrane skeletal system development extracellular matrix organizationDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez4323 17387Ensembl ENSG00000157227 ENSMUSG00000000957UniProt P50281 P53690RefSeq mRNK NM 004995NM 008608RefSeq bilok NP 004986NP 032634Lokus UCSC Hr 14 22 84 22 85 MbHr 14 54 67 54 68 MbPubMed search 2 3 VikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050MSPAPRPPRCLLLPLLTLGTALASLGSAQSSSFSPEAWLQQYGYLPPGDLRTHTQRSPQSLSAAIAAMQKFYGLQVTGKADADTMKAMRRPRCGVPDKFGAEIKANVRRKRYAIQGLKWQHNEITFCIQNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIFFAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDIFLVAVHELGHALGLEHSSDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGGESGFPTKMPPQPRTTSRPSVPDKPKNPTYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQFWRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALFWMPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKGNKYWKFNNQKLKVEPGYPKSALRDWMGCPSGGRPDEGTEEETEVIIIEVDEEGGGAVSAAAVVLPVLLLLLVLAVGLAVFFFRRHGTPRRLLYCQRSLLDKVA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do gidrolaz proteaz metaloproteaz fosfoproteyiniv Bilok maye sajt dlya zv yazuvannya z ionami metaliv ionom cinku ionom kalciyu Lokalizovanij u citoplazmi membrani Literatura RedaguvatiTakino T Sato H Yamamoto E Seiki M 1995 Cloning of a human gene potentially encoding a novel matrix metalloproteinase having a C terminal transmembrane domain Gene 155 293 298 PubMed DOI 10 1016 0378 1119 94 00637 8 Will H Hinzmann B 1995 cDNA sequence and mRNA tissue distribution of a novel human matrix metalloproteinase with a potential transmembrane segment Eur J Biochem 231 602 608 PubMed DOI 10 1111 j 1432 1033 1995 tb20738 x Lohi J L Westermarck J Kaehaeri V M Keski Oja J 1996 Regulation of membrane type matrix metalloproteinase 1 expression by growth factors and phorbol 12 myristate 13 acetate Eur J Biochem 239 239 247 PubMed DOI 10 1111 j 1432 1033 1996 0239u x The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PubMed DOI 10 1101 gr 2596504 Sato H Kinoshita T Takino T Nakayama K Seiki M 1996 Activation of a recombinant membrane type 1 matrix metalloproteinase MT1 MMP by furin and its interaction with tissue inhibitor of metalloproteinases TIMP 2 FEBS Lett 393 101 104 PubMed DOI 10 1016 0014 5793 96 00861 7 Gu G Zhao D Yin Z Liu P 2012 BST 2 binding with cellular MT1 MMP blocks cell growth and migration via decreasing MMP2 activity J Cell Biochem 113 1013 1021 PubMed DOI 10 1002 jcb 23433Primitki Redaguvati Spoluki yaki fizichno vzayemodiyut z Matrix metallopeptidase 14 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 7160 angl Procitovano 11 veresnya 2017 UniProt P50281 angl Arhiv originalu za 31 serpnya 2017 Procitovano 11 veresnya 2017 Div takozh RedaguvatiHromosoma 14 nbsp Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Otrimano z https uk wikipedia org w index php title MMP14 amp oldid 38242111