www.wikidata.uk-ua.nina.az
KCNE3 angl Potassium voltage gated channel subfamily E regulatory subunit 3 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 11 yi hromosomi 4 Dovzhina polipeptidnogo lancyuga bilka stanovit 103 aminokislot a molekulyarna masa 11 710 5 KCNE3IdentifikatoriSimvoliKCNE3 HOKPP HYPP MiRP2 potassium voltage gated channel subfamily E regulatory subunit 3 BRGDA6Zovnishni ID OMIM 604433 MGI 1891124 HomoloGene 3994 GeneCards KCNE3Pov yazani genetichni zahvoryuvannyaAstigmatizm 1 Ontologiya genaMolekulyarna funkciya potassium channel activity transmembrane transporter binding voltage gated ion channel activity potassium channel regulator activity GO 0001948 GO 0016582 protein binding voltage gated potassium channel activity delayed rectifier potassium channel activity voltage gated potassium channel activity involved in ventricular cardiac muscle cell action potential repolarizationKlitinna komponenta citoplazma integral component of membrane vezikula Perikarion cell projection membrana voltage gated potassium channel complex klitinna membrana neuronal cell body membrane Dendrit nejrobiologiya membrane raftBiologichnij proces regulation of potassium ion transport positive regulation of voltage gated calcium channel activity regulation of ion transmembrane transport ion transport potassium ion transport potassium ion transmembrane transport negative regulation of delayed rectifier potassium channel activity regulation of heart rate by cardiac conduction negative regulation of potassium ion export across plasma membrane negative regulation of voltage gated potassium channel activity negative regulation of membrane repolarization during ventricular cardiac muscle cell action potential regulation of ventricular cardiac muscle cell membrane repolarization ventricular cardiac muscle cell action potential membrane repolarization during action potential membrane repolarization during ventricular cardiac muscle cell action potential potassium ion export across plasma membraneDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez10008 57442Ensembl ENSG00000175538 ENSMUSG00000035165UniProt Q9Y6H6 Q9WTW2RefSeq mRNK NM 005472NM 001190869NM 001190870NM 001190871NM 001190950NM 020574NM 001360466NM 001360467RefSeq bilok NP 005463NP 001177798NP 001177799NP 001177800NP 001177879NP 065599NP 001347395NP 001347396Lokus UCSC Hr 11 74 45 74 47 MbHr 7 99 83 99 83 MbPubMed search 2 3 VikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050METTNGTETWYESLHAVLKALNATLHSNLLCRPGPGLGPDNQTEERRASLPGRDDNSYMYILFVMFLFAVTVGSLILGYTRSRKVDKRSDPYHVYIKNRVSMIA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do ionnih kanaliv potencialzalezhnih kanaliv Zadiyanij u takih biologichnih procesah yak transport ioniv transport transport kaliyu Bilok maye sajt dlya zv yazuvannya z kaliyu Lokalizovanij u klitinnij membrani citoplazmi membrani klitinnih vidrostkah Literatura red Melman Y F Domenech A de La Luna S McDonald T V 2001 Structural determinants of KvLQT1 control by the KCNE family of proteins J Biol Chem 276 6439 6444 PubMed DOI 10 1074 jbc M010713200 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PubMed DOI 10 1101 gr 2596504 Abbott G W Goldstein S A N 2002 Disease associated mutations in KCNE potassium channel subunits MiRPs reveal promiscuous disruption of multiple currents and conservation of mechanism FASEB J 16 390 400 PubMed DOI 10 1096 fj 01 0520hyp Dias Da Silva M R Cerutti J M Arnaldi L A T Maciel R M B 2002 A mutation in the KCNE3 potassium channel gene is associated with susceptibility to thyrotoxic hypokalemic periodic paralysis J Clin Endocrinol Metab 87 4881 4884 PubMed DOI 10 1210 jc 2002 020698 Sternberg D Tabti N Fournier E Hainque B Fontaine B 2003 Lack of association of the potassium channel associated peptide MiRP2 R83H variant with periodic paralysis Neurology 61 857 859 PubMed DOI 10 1212 01 WNL 0000082392 66713 E3 Jurkat Rott K Lehmann Horn F 2004 Periodic paralysis mutation MiRP2 R83H in controls Interpretations and general recommendation Neurology 62 1012 1015 PubMed DOI 10 1212 01 WNL 0000119392 29624 88Primitki red Zahvoryuvannya genetichno pov yazani z KCNE3 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 6243 angl Procitovano 8 veresnya 2017 UniProt Q9Y6H6 angl Arhiv originalu za 20 grudnya 2016 Procitovano 8 veresnya 2017 Div takozh red Hromosoma 11 nbsp Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Otrimano z https uk wikipedia org w index php title KCNE3 amp oldid 38963441