HDAC1 angl Histone deacetylase 1 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 1 yi hromosomi 4 Dovzhina polipeptidnogo lancyuga bilka stanovit 482 aminokislot a molekulyarna masa 55 103 5 HDAC1Nayavni strukturiPDBPoshuk ortologiv PDBe RCSBSpisok kodiv PDB4BKX 5ICNIdentifikatoriSimvoliHDAC1 GON 10 HD1 RPD3 RPD3L1 histone deacetylase 1 KDAC1Zovnishni ID OMIM 601241 MGI 108086 HomoloGene 68426 GeneCards HDAC1Reaguye na spolukuabexinostat apicidin belinostat Maslyana kislota entinostat givinostat mocetinostat panobinostat pracinostat quisinostat resminostat romidepsin trichostatin A Valproyeva kislota Zolinza entinostat cudc 101 cudc 907 tacedinaline 1 Ontologiya genaMolekulyarna funkciya GO 0000980 RNA polymerase II cis regulatory region sequence specific DNA binding NAD dependent histone deacetylase activity H3 K14 specific GO 0001106 transcription corepressor activity histone deacetylase activity protein N terminus binding GO 0001131 GO 0001151 GO 0001130 GO 0001204 DNA binding transcription factor activity protein deacetylase activity histone deacetylase binding GO 0000975 transcription cis regulatory region binding NF kappaB binding deacetylase activity GO 0001948 GO 0016582 protein binding nucleosomal DNA binding enzyme binding hydrolase activity core promoter sequence specific DNA binding p53 binding transcription factor binding RNA polymerase II core promoter sequence specific DNA binding DNA binding chromatin binding Krueppel associated box domain binding E box binding promoter specific chromatin bindingKlitinna komponenta citoplazma NuRD complex gialoplazma histone deacetylase complex Sin3 complex Nukleoplazma klitinne yadro Hromatin GO 0035328 Geterohromatin transcription regulator complex transcription repressor complex GO 0009327 protein containing complex neuronal cell body Sin3 type complexBiologichnij proces hair follicle placode formation epidermal cell differentiation Remodelyuvannya hromatinu GO 0009373 regulation of transcription DNA templated ritmichnij proces negative regulation of androgen receptor signaling pathway embryonic digit morphogenesis negative regulation of apoptotic process zsidannya krovi GO 1901227 negative regulation of transcription by RNA polymerase II eyelid development in camera type eye circadian regulation of gene expression negative regulation of gene expression GO 0060469 GO 0009371 positive regulation of transcription DNA templated odontogenesis of dentin containing tooth protein deacetylation histone H4 deacetylation fungiform papilla formation negative regulation of myotube differentiation GO 0022415 viral process histone deacetylation negative regulation of canonical Wnt signaling pathway GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II transcription DNA templated regulation of signal transduction by p53 class mediator DNA methylation dependent heterochromatin assembly beta catenin TCF complex assembly GO 0031497 GO 0006336 GO 0034724 GO 0001301 GO 0007580 GO 0034652 GO 0010847 chromatin organization positive regulation of cell population proliferation GO 0045996 negative regulation of transcription DNA templated histone H3 deacetylation regulation of megakaryocyte differentiation GO 0044324 GO 0003256 GO 1901213 GO 0046019 GO 0046020 GO 1900094 GO 0061216 GO 0060994 GO 1902064 GO 0003258 GO 0072212 regulation of transcription by RNA polymerase II endoderm development cirkadnij ritm hippocampus development neuron differentiation negative regulation of I kappaB kinase NF kappaB signaling positive regulation of oligodendrocyte differentiation regulation of endopeptidase activity regulation of amyloid beta clearance negative regulation of intrinsic apoptotic signaling pathwayDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez3065 433759Ensembl ENSG00000116478 ENSMUSG00000028800UniProt Q13547 O09106RefSeq mRNK NM 004964NM 008228RefSeq bilok NP 004955NP 032254Lokus UCSC Hr 1 32 29 32 33 MbHr 4 129 41 129 44 MbPubMed search 2 3 VikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLAA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do represoriv gidrolaz regulyatoriv hromatinu Zadiyanij u takih biologichnih procesah yak vzayemodiya hazyayin virus transkripciya regulyaciya transkripciyi biologichni ritmi Lokalizovanij u yadri Literatura red Taunton J Hassig C A Schreiber S L 1996 A mammalian histone deacetylase related to the yeast transcriptional regulator Rpd3p Science 272 408 411 PubMed DOI 10 1126 science 272 5260 408 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PubMed DOI 10 1101 gr 2596504 Cai R L Yan Neale Y Cueto M A Xu H Cohen D 2000 HDAC1 a histone deacetylase forms a complex with Hus1 and Rad9 two G2 M checkpoint Rad proteins J Biol Chem 275 27909 27916 PubMed DOI 10 1074 jbc M000168200 Wei L N Hu X Chandra D Seto E Farooqui M 2000 Receptor interacting protein 140 directly recruits histone deacetylases for gene silencing J Biol Chem 275 40782 40787 PubMed DOI 10 1074 jbc M004821200 Zhou X Richon V M Rifkind R A Marks P A 2000 Identification of a transcriptional repressor related to the noncatalytic domain of histone deacetylases 4 and 5 Proc Natl Acad Sci U S A 97 1056 1061 PubMed DOI 10 1073 pnas 97 3 1056 Pflum M K H Tong J K Lane W S Schreiber S L 2001 Histone deacetylase 1 phosphorylation promotes enzymatic activity and complex formation J Biol Chem 276 47733 47741 PubMed DOI 10 1074 jbc M105590200Primitki red Spoluki yaki fizichno vzayemodiyut z histone deacetylase 1 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 4852 angl Arhiv originalu za 14 lipnya 2017 Procitovano 25 serpnya 2017 UniProt Q13547 angl Arhiv originalu za 12 serpnya 2017 Procitovano 25 serpnya 2017 Div takozh red Hromosoma 1 nbsp Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Otrimano z https uk wikipedia org w index php title HDAC1 amp oldid 35628312
