FHIT angl Fragile histidine triad bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 3 yi hromosomi 4 Dovzhina polipeptidnogo lancyuga bilka stanovit 147 aminokislot a molekulyarna masa 16 858 5 FHITNayavni strukturiPDBPoshuk ortologiv PDBe RCSBSpisok kodiv PDB1FHI 2FHI 2FIT 5FIT 3FIT 1FIT 4FIT 6FITIdentifikatoriSimvoliFHIT AP3Aase FRA3B fragile histidine triad triada histidina fragil fragile histidine triad diadenosine triphosphataseZovnishni ID OMIM 601153 MGI 1277947 HomoloGene 21661 GeneCards FHITPov yazani genetichni zahvoryuvannyakorotkozorist Rozsheplennya pidnebinnya sindrom Aspergera rozlad deficitu uvagi ta giperaktivnosti 1 Ontologiya genaMolekulyarna funkciya bis 5 adenosyl triphosphatase activity nucleotide binding katalitichna aktivnist hydrolase activity GO 0001948 GO 0016582 protein binding ubiquitin protein ligase binding identical protein bindingKlitinna komponenta citoplazma gialoplazma mitohondriya klitinne yadro fibrillar center klitinna membranaBiologichnij proces negative regulation of proteasomal ubiquitin dependent protein catabolic process purine nucleotide metabolic process GO 0009373 regulation of transcription DNA templated nucleotide metabolic process transcription DNA templated intrinsic apoptotic signaling pathway by p53 class mediator GO 0097285 apoptozDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez2272 14198Ensembl ENSG00000189283 ENSMUSG00000060579UniProt P49789 O89106RefSeq mRNK NM 001166243NM 002012NM 001320899NM 001320900NM 001320901NM 001354589NM 001354590NM 010210NM 001308285NM 001308286NM 001360141RefSeq bilok NP 001159715NP 001307828NP 001307829NP 001307830NP 002003NP 001341518NP 001341519NP 001295214NP 001295215NP 034340NP 001347070Lokus UCSC Hr 3 59 75 61 25 MbHr 14 11 31 12 92 MbPubMed search 2 3 VikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEAAALRVYFQA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do gidrolaz fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak apoptoz transkripciya regulyaciya transkripciyi Bilok maye sajt dlya zv yazuvannya z nukleotidami ionom margancyu Lokalizovanij u citoplazmi yadri mitohondriyi Literatura red The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Shi Y Zou M Farid N R Paterson M C 2000 Association of FHIT fragile histidine triad a candidate tumour suppressor gene with the ubiquitin conjugating enzyme hUBC9 Biochem J 352 443 448 PMID 11085938 DOI 10 1042 bj3520443 Huang K Arabshahi A Wei Y Frey P A 2004 The mechanism of action of the fragile histidine triad Fhit isolation of a covalent adenylyl enzyme and chemical rescue of H96G Fhit Biochemistry 43 7637 7642 PMID 15182206 DOI 10 1021 bi049762n Weiske J Albring K F Huber O 2007 The tumor suppressor Fhit acts as a repressor of beta catenin transcriptional activity Proc Natl Acad Sci U S A 104 20344 20349 PMID 18077326 DOI 10 1073 pnas 0703664105 Lima C D Klein M G Hendrickson W A 1997 Structure based analysis of catalysis and substrate definition in the HIT protein family Science 278 286 290 PMID 9323207 DOI 10 1126 science 278 5336 286Primitki red Zahvoryuvannya genetichno pov yazani z FHIT pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 3701 angl Arhiv originalu za 17 zhovtnya 2015 Procitovano 30 serpnya 2017 UniProt P49789 angl Arhiv originalu za 17 serpnya 2017 Procitovano 30 serpnya 2017 Div takozh red Hromosoma 3 nbsp Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Otrimano z https uk wikipedia org w index php title FHIT amp oldid 35438212
