CETN2 angl Centrin 2 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na X hromosomi 3 Dovzhina polipeptidnogo lancyuga bilka stanovit 172 aminokislot a molekulyarna masa 19 738 4 CETN2Nayavni strukturiPDBPoshuk ortologiv PDBe RCSBSpisok kodiv PDB1M39 1ZMZ 2A4J 2GGM 2K2I 2OBHIdentifikatoriSimvoliCETN2 CALT CEN2 centrin 2Zovnishni ID OMIM 300006 MGI 1347085 HomoloGene 55798 GeneCards CETN2Ontologiya genaMolekulyarna funkciya heterotrimeric G protein binding zv yazuvannya z ionom metalu calcium ion binding G protein beta gamma subunit complex binding microtubule binding GO 0001948 GO 0016582 protein bindingKlitinna komponenta photoreceptor connecting cilium Centriol citoplazma Nukleoplazma ciliary basal body gialoplazma klitinne yadro XPC complex centrosoma vnutrishnoklitinnij Vijka Citoskelet Centr organizaciyi mikrotrubochok nuclear pore nuclear basket transcription export complex 2 nuclear envelope Yaderna poraBiologichnij proces nucleotide excision repair DNA damage recognition klitinnij cikl Spermatogenez podil klitini G2 M transition of mitotic cell cycle regulation of cytokinesis centriole replication cellular response to DNA damage stimulus global genome nucleotide excision repair nucleotide excision repair preincision complex assembly GO 0100026 Reparaciya DNK nucleotide excision repair ciliary basal body plasma membrane docking GO 0007067 mitoz regulation of G2 M transition of mitotic cell cycle mitotic cytokinesis regulation of centrosome duplication calcium mediated signaling microtubule cytoskeleton organization nucleotide excision repair DNA duplex unwinding protein transport mRNA transportDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez1069 26370Ensembl ENSG00000147400 ENSMUSG00000031347UniProt P41208 Q9R1K9RefSeq mRNK NM 004344NM 019405RefSeq bilok NP 004335NP 062278Lokus UCSC Hr X 152 83 152 83 MbHr X 71 96 71 96 MbPubMed search 1 2 VikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050MASNFKKANMASSSQRKRMSPKPELTEEQKQEIREAFDLFDADGTGTIDVKELKVAMRALGFEPKKEEIKKMISEIDKEGTGKMNFGDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVSEQEFLRIMKKTSLYA Alanin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak klitinnij cikl podil klitini poshkodzhennya DNK reparaciya DNK mitoz acetilyuvannya Bilok maye sajt dlya zv yazuvannya z ionami metaliv ionom kalciyu Lokalizovanij u citoplazmi citoskeleti yadri Literatura RedaguvatiLee V D Huang B 1993 Molecular cloning and centrosomal localization of human caltractin Proc Natl Acad Sci U S A 90 11039 11043 PubMed DOI 10 1073 pnas 90 23 11039 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PubMed DOI 10 1101 gr 2596504 Salisbury J L Suino K M Busby R Springett M 2002 Centrin 2 is required for centriole duplication in mammalian cells Curr Biol 12 1287 1292 PubMed DOI 10 1016 S0960 9822 02 01019 9 Bunick C G Miller M R Fuller B E Fanning E Chazin W J 2006 Biochemical and structural domain analysis of xeroderma pigmentosum complementation group C protein Biochemistry 45 14965 14979 PubMed DOI 10 1021 bi061370o Thompson J R Ryan Z C Salisbury J L Kumar R 2006 The structure of the human centrin 2 xeroderma pigmentosum group C protein complex J Biol Chem 281 18746 18752 PubMed DOI 10 1074 jbc M513667200Primitki Redaguvati Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 1867 angl Arhiv originalu za 20 lipnya 2017 Procitovano 12 veresnya 2017 UniProt P41208 angl Arhiv originalu za 19 serpnya 2017 Procitovano 12 veresnya 2017 Div takozh RedaguvatiHromosoma X nbsp Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Otrimano z https uk wikipedia org w index php title CETN2 amp oldid 35582751
