CDKN2A angl Cyclin dependent kinase inhibitor 2A bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 9 yi hromosomi 4 Dovzhina polipeptidnogo lancyuga bilka stanovit 156 aminokislot a molekulyarna masa 16 533 5 CDKN2ANayavni strukturiPDBPoshuk ortologiv PDBe RCSBSpisok kodiv PDB2A5E 1A5E 1BI7 1DC2 s1A5E 1BI7 1DC2 2A5EIdentifikatoriSimvoliCDKN2A CDK4I CDKN2 CMM2 INK4 INK4A MLM MTS 1 MTS1 P14 P14ARF P16 P16 INK4A P16INK4 P16INK4A P19 P19ARF TP16 cyclin dependent kinase inhibitor 2A cyclin dependent kinase inhibitor 2A Genes p16 ARF Zovnishni ID OMIM 600160 MGI 104738 HomoloGene 55430 GeneCards CDKN2APov yazani genetichni zahvoryuvannyamelanoma pancreatic cancer syndrome mucosal melanoma melanoma familial atypical multiple mole melanoma syndrome 1 Ontologiya genaMolekulyarna funkciya NF kappaB binding GO 0001948 GO 0016582 protein binding cyclin dependent protein serine threonine kinase inhibitor activity protein kinase binding RNA binding DNA binding p53 binding transcription factor binding MDM2 MDM4 family protein binding ubiquitin protein transferase inhibitor activity SUMO transferase activity disordered domain specific binding GO 0090645 GO 0061637 ubiquitin ligase inhibitor activityKlitinna komponenta citoplazma gialoplazma senescence associated heterochromatin focus klitinne yadro Yaderni tilcya Nukleoplazma Yaderce mitohondriya GO 0009327 protein containing complexBiologichnij proces positive regulation of smooth muscle cell apoptotic process negative regulation of cyclin dependent protein serine threonine kinase activity replicative senescence G1 phase negative regulation of cell matrix adhesion klitinne starinnya negative regulation of cell growth positive regulation of cellular senescence positive regulation of macrophage apoptotic process klitinnij cikl Ras protein signal transduction negative regulation of phosphorylation GO 0045996 negative regulation of transcription DNA templated negative regulation of NF kappaB transcription factor activity negative regulation of cell population proliferation G1 S transition of mitotic cell cycle GO 1990376 negative regulation of G1 S transition of mitotic cell cycle GO 0097285 Apoptoz regulation of G2 M transition of mitotic cell cycle GO 0009373 regulation of transcription DNA templated regulation of protein stability negative regulation of immature T cell proliferation in thymus regulation of protein export from nucleus negative regulation of protein kinase activity negative regulation of proteolysis involved in cellular protein catabolic process protein K63 linked ubiquitination positive regulation of signal transduction by p53 class mediator somatic stem cell division protein stabilization protein polyubiquitination positive regulation of protein sumoylation transcription DNA templated GO 0060469 GO 0009371 positive regulation of transcription DNA templated autophagy of mitochondrion apoptotic mitochondrial changes regulation of protein targeting to mitochondrion protein destabilization negative regulation of ubiquitin protein transferase activity positive regulation of apoptotic process rRNA processing negative regulation of ubiquitin dependent protein catabolic process mitochondrial depolarization positive regulation of DNA damage response signal transduction by p53 class mediator negative regulation of B cell proliferation activation of cysteine type endopeptidase activity involved in apoptotic process regulation of apoptotic DNA fragmentation GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II positive regulation of protein localization to nucleus protein sumoylation GO 1901313 positive regulation of gene expression GO 0060564 GO 1904190 negative regulation of ubiquitin protein ligase activity amyloid fibril formation negative regulation of protein neddylationDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez1029 12578Ensembl ENSG00000147889 ENSMUSG00000044303UniProt P42771Q8N726 P51480Q64364RefSeq mRNK NM 000077NM 001195132NM 058195NM 058196NM 058197NM 001363763NM 001040654NM 009877RefSeq bilok NP 000068NP 001182061NP 478102NP 478104NP 001350692NP 478102 2NP 001035744NP 034007NP 034007 1Lokus UCSC Hr 9 21 97 22 MbHr 4 89 19 89 21 MbPubMed search 2 3 VikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPDA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak klitinnij cikl acetilyuvannya alternativnij splajsing Lokalizovanij u citoplazmi yadri Literatura red Serrano M Hannon G J Beach D 1993 A new regulatory motif in cell cycle control causing specific inhibition of cyclin D CDK4 Nature 366 704 707 PubMed DOI 10 1038 366704a0 Robertson K D Jones P A 1999 Tissue specific alternative splicing in the human INK4a ARF cell cycle regulatory locus Oncogene 18 3810 3820 PubMed DOI 10 1038 sj onc 1202737 Gump J Stokoe D McCormick F 2003 Phosphorylation of p16INK4A correlates with Cdk4 association J Biol Chem 278 6619 6622 PubMed DOI 10 1074 jbc C200622200 Russo A A Tong L Lee J O Jeffrey P D Pavletich N P 1998 Structural basis for inhibition of the cyclin dependent kinase Cdk6 by the tumour suppressor p16INK4a Nature 395 237 243 PubMed DOI 10 1038 26155 Yuan C Li J Selby T L Byeon I J Tsai M D 1999 Tumor suppressor INK4 comparisons of conformational properties between p16 INK4A and p18 INK4C J Mol Biol 294 201 211 PubMed DOI 10 1006 jmbi 1999 3231 Yuan C Selby T L Li J Byeon I J Tsai M D 2000 Tumor suppressor INK4 refinement of p16INK4A structure and determination of p15INK4B structure by comparative modeling and NMR data Protein Sci 9 1120 1128 PubMed DOI 10 1110 ps 9 6 1120Primitki red Zahvoryuvannya genetichno pov yazani z CDKN2A pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 1787 angl Arhiv originalu za 16 bereznya 2016 Procitovano 8 veresnya 2017 UniProt P42771 angl Arhiv originalu za 13 veresnya 2017 Procitovano 8 veresnya 2017 Div takozh red Hromosoma 9 nbsp Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Otrimano z https uk wikipedia org w index php title CDKN2A amp oldid 35582485
