BAD angl BCL2 associated agonist of cell death bilok simejstva Bcl 2 pidsimejstva viklyuchno BH 3 domennih bilkiv Zaluchenij u procesah iniciaciyi apoptozu Pislya aktivaciyi cej bilok zdatnij utvoryuvati geterodimeri z antiapoptotichnimi bilkami Bcl 2 ta Bcl xL en ta usuvati yih z procesu zupinennya apoptozu Koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 11 yi hromosomi 3 Dovzhina polipeptidnogo lancyuga bilka stanovit 168 aminokislot a molekulyarna masa 18 392 4 BADNayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1G5JIdentifikatoriSimvoliBAD BBC2 BCL2L8 BCL2 associated agonist of cell deathZovnishni ID OMIM 603167 MGI 1096330 HomoloGene 3189 GeneCards BADOntologiya genaMolekulyarna funkciya 14 3 3 protein binding protein phosphatase binding GO 0001948 GO 0016582 protein binding protein heterodimerization activity cysteine type endopeptidase activator activity involved in apoptotic process phospholipid binding protein kinase binding lipid binding protein phosphatase 2B binding protein kinase B bindingKlitinna komponenta citoplazma gialoplazma membrana mitohondrialna zovnishnya membrana mitohondriyaBiologichnij proces positive regulation of T cell differentiation cellular response to hypoxia regulation of apoptotic process response to amino acid response to estradiol response to hypoxia positive regulation of type B pancreatic cell development GO 1904578 response to organic cyclic compound extrinsic apoptotic signaling pathway positive regulation of autophagy glucose homeostasis cytokine mediated signaling pathway response to testosterone positive regulation of epithelial cell proliferation positive regulation of B cell differentiation response to progesterone positive regulation of apoptotic process by virus pore complex assembly cellular response to nicotine response to glucocorticoid positive regulation of neuron death response to glucose regulation of cysteine type endopeptidase activity involved in apoptotic process response to organic substance response to calcium ion positive regulation of cysteine type endopeptidase activity involved in apoptotic process ATP metabolic process cellular response to mechanical stimulus activation of cysteine type endopeptidase activity regulation of mitochondrial membrane permeability positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway positive regulation of intrinsic apoptotic signaling pathway positive regulation of glucokinase activity Spermatogenez glucose catabolic process intrinsic apoptotic signaling pathway in response to DNA damage positive regulation of proteolysis cerebral cortex development extrinsic apoptotic signaling pathway in absence of ligand cellular response to lipid positive regulation of release of cytochrome c from mitochondria response to hormone positive regulation of mitochondrial membrane potential positive regulation of insulin secretion involved in cellular response to glucose stimulus suppression by virus of host apoptotic process response to ethanol ADP metabolic process activation of cysteine type endopeptidase activity involved in apoptotic process proliferaciya type B pancreatic cell proliferation cellular response to chromate extrinsic apoptotic signaling pathway via death domain receptors response to hydrogen peroxide response to oleic acid release of cytochrome c from mitochondria positive regulation of insulin secretion GO 0097285 apoptoz intrinsic apoptotic signaling pathway apoptotic signaling pathway protein insertion into mitochondrial membrane involved in apoptotic signaling pathway positive regulation of intrinsic apoptotic signaling pathway in response to osmotic stress positive regulation of apoptotic process positive regulation of granulosa cell apoptotic processDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez572 12015Ensembl ENSG00000002330 ENSMUSG00000024959UniProt Q92934 Q61337RefSeq mRNK NM 032989NM 004322NM 007522NM 001285453RefSeq bilok NP 004313NP 116784NP 001272382NP 031548Lokus UCSC Hr 11 64 27 64 28 MbHr 19 6 92 6 93 MbPubMed search 1 2 VikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASH QQEQPTSSSHHGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSA PPNLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWTRV FQSWWDRNLGRGSSAPSQ A Alanin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom BAD gene Arhivovano 8 sichnya 2019 u Wayback Machine bilok za funkciyeyu nalezhit do fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak apoptoz acetilyuvannya Lokalizovanij u citoplazmi klitinnij membrani zovnishnij membrani mitohondrij Na vidminu vid bilshosti inshih bilkiv simejstva Bcl 2 ne mistit C kincevogo transmembrannogo domenu v strukturi zovnishnoyi mitohondrialnoyi membrani ta membrani yadra Zmist 1 Vlastivosti 2 p BAD 3 Literatura 4 Primitki 5 Div takozhVlastivosti red Vvazhayetsya sho Bcl 2 gomologichni bilki zdatni do asociaciyi z BAD mayut yak pro tak i antiapoptozni vlastivosti Tak Bax Bak bilki spriyayut iniciaciyi apoptozu shlyahom utvorennya pori u zovnishnij membrani mitohondrij Ce prizvodit do vidilennya citohromu S vseredinu citoplazmi ta aktivaciyi proapoptoznogo kaspaznogo kaskadu Natomist sam Bcl 2 ta jogo gomolog Bcl xL en diyut antiapoptotichno ingibuyut vivilnennya citohromu S cherez membrannu poru mitohondriyi ta poperedzhuyut aktivaciyu kaspaznogo kaskadu Defosforilyuvani formi BAD pid diyeyu Ca2 zalezhnogo kalcinevrinu spriyayut apoptozu Defosforilovani formi bilka BAD formuyut geterodimeri razom z Bcl 2 ta Bcl xL en inaktivuyut yih ta spriyayut Bax Bak skerovanomu rozgortannyu kaspaznogo kaskadu apoptozu pid diyeyu citohromu S Mehanizmi defosforilyuvannya BAD mozhut spriyati rozvitku nejrodegenerativnih zahvoryuvan napriklad shizofreniyi p BAD red Fosforilovani formi bilka BAD p BAD phospho BAD ye antiapoptoznimi agentami Fosforilyuvannya bilka BAD diyeyu Akt Protein kinase B en prizvodit do formuvannya BAD 14 3 3 geterodimera en Takij geterodimer ne mozhe zv yazuvatisya z Bcl 2 Yak naslidok antiapoptotichni vlastivosti Bcl 2 zberigayutsya a Bax zalezhne vivilnennya citohromu S ne mozhe rozpochatisya i ne prizvodit do rozgortannya apoptozu Literatura red Wang H G Rapp U R Reed J C 1996 Bcl 2 targets the protein kinase Raf 1 to mitochondria Cell 87 629 638 PMID 8929532 DOI 10 1016 S0092 8674 00 81383 5 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Gnesutta N Qu J Minden A 2001 The serine threonine kinase PAK4 prevents caspase activation and protects cells from apoptosis J Biol Chem 276 14414 14419 PMID 11278822 DOI 10 1074 jbc M011046200 Cotteret S Jaffer Z M Beeser A Chernoff J 2003 p21 Activated kinase 5 Pak5 localizes to mitochondria and inhibits apoptosis by phosphorylating BAD Mol Cell Biol 23 5526 5539 PMID 12897128 DOI 10 1128 MCB 23 16 5526 5539 2003Primitki red Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 936 angl Arhiv originalu za 16 lipnya 2017 Procitovano 8 veresnya 2017 UniProt Q92934 angl Arhiv originalu za 17 veresnya 2017 Procitovano 8 veresnya 2017 Div takozh red Hromosoma 11 nbsp Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Otrimano z https uk wikipedia org w index php title BAD amp oldid 39616432
