BAX (англ. BCL2 associated X, apoptosis regulator) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми. Довжина поліпептидного ланцюга білка становить 192 амінокислот, а молекулярна маса — 21 184.
BAX | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | BAX, BCL2L4, BCL2 associated X protein, BCL2 associated X, apoptosis regulator | ||||||||||||||||
Зовнішні ІД | OMIM: 600040 MGI: 99702 HomoloGene: 7242 GeneCards: BAX | ||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 19: 48.95 – 48.96 Mb | Хр. 7: 45.11 – 45.12 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MDGSGEQPRG | GGPTSSEQIM | KTGALLLQGF | IQDRAGRMGG | EAPELALDPV | ||||
PQDASTKKLS | ECLKRIGDEL | DSNMELQRMI | AAVDTDSPRE | VFFRVAADMF | ||||
SDGNFNWGRV | VALFYFASKL | VLKALCTKVP | ELIRTIMGWT | LDFLRERLLG | ||||
WIQDQGGWDG | LLSYFGTPTW | QTVTIFVAGV | LTASLTIWKK | MG |
Задіяний у таких біологічних процесах, як апоптоз, взаємодія хазяїн-вірус, ацетилювання, альтернативний сплайсинг. Локалізований у цитоплазмі, мембрані, мітохондрії.
Література
- Oltvai Z.N., Milliman C.L., Korsmeyer S.J. (1993). Bcl-2 heterodimerizes in vivo with a conserved homolog, Bax, that accelerates programmed cell death. Cell. 74: 609—619. PMID 8358790 DOI:10.1016/0092-8674(93)90509-O
- Apte S.S., Mattei M.-G., Olsen B.R. (1995). Mapping of the human BAX gene to chromosome 19q13.3-q13.4 and isolation of a novel alternatively spliced transcript, BAX delta. Genomics. 26: 592—594. PMID 7607685 DOI:10.1016/0888-7543(95)80180-T
- Schmitt E., Paquet C., Beauchemin M., Dever-Bertrand J., Bertrand R. (2000). Characterization of Bax-sigma, a cell death-inducing isoform of Bax. Biochem. Biophys. Res. Commun. 270: 868—879. PMID 10772918 DOI:10.1006/bbrc.2000.2537
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Nechushtan A., Smith C.L., Hsu Y.-T., Youle R.J. (1999). Conformation of the Bax C-terminus regulates subcellular location and cell death. EMBO J. 18: 2330—2341. PMID 10228148 DOI:10.1093/emboj/18.9.2330
- Gustafsson A.B., Tsai J.G., Logue S.E., Crow M.T., Gottlieb R.A. (2004). Apoptosis repressor with caspase recruitment domain protects against cell death by interfering with Bax activation. J. Biol. Chem. 279: 21233—21238. PMID 15004034 DOI:10.1074/jbc.M400695200
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- (англ.) . Архів оригіналу за 16 липня 2017. Процитовано 12 вересня 2017.
- (англ.) . Архів оригіналу за 18 серпня 2017. Процитовано 12 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
BAX angl BCL2 associated X apoptosis regulator bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 19 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 192 aminokislot a molekulyarna masa 21 184 BAXNayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB4BDU 1F16 2G5B 2K7W 2LR1 3PK1 3PL7 4BD2 4BD6 4BD7 4BD8 4UF2 4ZIE 4ZIF 4ZIG 4ZIH 4ZII 4S0OIdentifikatoriSimvoliBAX BCL2L4 BCL2 associated X protein BCL2 associated X apoptosis regulatorZovnishni ID OMIM 600040 MGI 99702 HomoloGene 7242 GeneCards BAXOntologiya genaMolekulyarna funkciya protein homodimerization activity channel activity GO 0001948 GO 0016582 protein binding BH3 domain binding chaperone binding protein heterodimerization activity identical protein binding lipid binding Hsp70 protein bindingKlitinna komponenta gialoplazma nuclear envelope membrana Bcl 2 family protein complex mitohondriya klitinne yadro mitochondrial permeability transition pore complex mitohondrialna membrana BAX complex endoplazmatichnij retikulum ekzosoma pore complex integral component of membrane vnutrishnoklitinnij endoplasmic reticulum membrane citoplazma mitohondrialna zovnishnya membrana cell peripheryBiologichnij proces GO 1904089 negative regulation of neuron apoptotic process response to ionizing radiation germ cell development positive regulation of calcium ion transport into cytosol glycosphingolipid metabolic process B cell apoptotic process response to salt stress Sertoli cell proliferation thymocyte apoptotic process T cell homeostatic proliferation post embryonic development regulation of mitochondrial membrane permeability involved in apoptotic process negative regulation of protein binding cellular response to DNA damage stimulus regulation of mitochondrial membrane permeability involved in programmed necrotic cell death odontogenesis of dentin containing tooth positive regulation of extrinsic apoptotic signaling pathway in absence of ligand positive regulation of IRE1 mediated unfolded protein response blood vessel remodeling positive regulation of neuron apoptotic process apoptotic process involved in blood vessel morphogenesis activation of cysteine type endopeptidase activity involved in apoptotic process by cytochrome c Spermatogenez apoptotic signaling pathway proliferaciya mitochondrion morphogenesis activation of cysteine type endopeptidase activity involved in apoptotic process negative regulation of cell population proliferation cellular response to organic substance B cell homeostatic proliferation limb morphogenesis release of matrix enzymes from mitochondria extrinsic apoptotic signaling pathway rozvitok nirki activation of cysteine type endopeptidase activity involved in apoptotic signaling pathway negative regulation of apoptotic signaling pathway myeloid cell homeostasis regulation of neuron apoptotic process regulation of cysteine type endopeptidase activity involved in apoptotic process endoplasmic reticulum calcium ion homeostasis response to wounding intrinsic apoptotic signaling pathway by p53 class mediator hypothalamus development GO 0022415 viral process protein homooligomerization response to gamma radiation negative regulation of fibroblast proliferation positive regulation of intrinsic apoptotic signaling pathway response to toxic substance B cell negative selection GO 1990613 mitochondrial fusion neuron apoptotic process male gonad development positive regulation of B cell apoptotic process regulation of protein heterodimerization activity positive regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway cellular response to UV sex differentiation neuron migration B cell homeostasis positive regulation of release of sequestered calcium ion into cytosol positive regulation of apoptotic process involved in mammary gland involution nejrobiologiya rozvitku spermatid differentiation development of secondary sexual characteristics positive regulation of developmental pigmentation retina development in camera type eye response to axon injury positive regulation of mitochondrial membrane permeability involved in apoptotic process cerebral cortex development ovarian follicle development zaplidnennya ectopic germ cell programmed cell death homeostasis of number of cells within a tissue positive regulation of release of cytochrome c from mitochondria B cell receptor apoptotic signaling pathway negative regulation of endoplasmic reticulum calcium ion concentration regulation of protein homodimerization activity apoptotic process involved in embryonic digit morphogenesis leukocyte homeostasis positive regulation of apoptotic DNA fragmentation mitochondrial fragmentation involved in apoptotic process positive regulation of endoplasmic reticulum unfolded protein response establishment or maintenance of transmembrane electrochemical gradient homeostasis of number of cells vagina development post embryonic camera type eye morphogenesis regulation of mammary gland epithelial cell proliferation retinal cell programmed cell death regulation of cell cycle regulation of mitochondrial membrane potential intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress apoptotic mitochondrial changes protein complex oligomerization regulation of nitrogen utilization negative regulation of peptidyl serine phosphorylation positive regulation of apoptotic process positive regulation of protein oligomerization extrinsic apoptotic signaling pathway via death domain receptors release of cytochrome c from mitochondria GO 0097285 apoptoz protein insertion into mitochondrial membrane involved in apoptotic signaling pathway intrinsic apoptotic signaling pathway regulation of apoptotic process DNA damage response signal transduction by p53 class mediator resulting in cell cycle arrest intrinsic apoptotic signaling pathway in response to DNA damage extrinsic apoptotic signaling pathway in absence of ligand transcription initiation from RNA polymerase II promoter Unfolded Protein Response negative regulation of mitochondrial membrane potentialDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez581 12028Ensembl ENSG00000087088 ENSMUSG00000003873UniProt Q07812 Q5ZPJ0 Q07813RefSeq mRNK NM 001291428 NM 001291429 NM 001291430 NM 001291431 NM 004324NM 138761 NM 138762 NM 138763 NM 138764NM 007527RefSeq bilok NP 001278357 NP 001278358 NP 001278359 NP 001278360 NP 004315NP 620116 NP 620118 NP 620119 NP 001278358 1NP 031553Lokus UCSC Hr 19 48 95 48 96 MbHr 7 45 11 45 12 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPV PQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMF SDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLG WIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Zadiyanij u takih biologichnih procesah yak apoptoz vzayemodiya hazyayin virus acetilyuvannya alternativnij splajsing Lokalizovanij u citoplazmi membrani mitohondriyi LiteraturaOltvai Z N Milliman C L Korsmeyer S J 1993 Bcl 2 heterodimerizes in vivo with a conserved homolog Bax that accelerates programmed cell death Cell 74 609 619 PMID 8358790 DOI 10 1016 0092 8674 93 90509 O Apte S S Mattei M G Olsen B R 1995 Mapping of the human BAX gene to chromosome 19q13 3 q13 4 and isolation of a novel alternatively spliced transcript BAX delta Genomics 26 592 594 PMID 7607685 DOI 10 1016 0888 7543 95 80180 T Schmitt E Paquet C Beauchemin M Dever Bertrand J Bertrand R 2000 Characterization of Bax sigma a cell death inducing isoform of Bax Biochem Biophys Res Commun 270 868 879 PMID 10772918 DOI 10 1006 bbrc 2000 2537 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Nechushtan A Smith C L Hsu Y T Youle R J 1999 Conformation of the Bax C terminus regulates subcellular location and cell death EMBO J 18 2330 2341 PMID 10228148 DOI 10 1093 emboj 18 9 2330 Gustafsson A B Tsai J G Logue S E Crow M T Gottlieb R A 2004 Apoptosis repressor with caspase recruitment domain protects against cell death by interfering with Bax activation J Biol Chem 279 21233 21238 PMID 15004034 DOI 10 1074 jbc M400695200PrimitkiHuman PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 16 lipnya 2017 Procitovano 12 veresnya 2017 angl Arhiv originalu za 18 serpnya 2017 Procitovano 12 veresnya 2017 Div takozhHromosoma 19 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi