VEGFA angl Vascular endothelial growth factor A bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 6 yi hromosomi 4 Dovzhina polipeptidnogo lancyuga bilka stanovit 232 aminokislot a molekulyarna masa 27 042 5 VEGFANayavni strukturiPDBPoshuk ortologiv H0YBI8 PDBe H0YBI8 RCSBSpisok kodiv PDB1BJ1 1CZ8 1FLT 1KAT 1KMX 1MJV 1MKG 1MKK 1QTY 1TZH 1TZI 1VGH 1VPF 1VPP 2FJG 2FJH 2QR0 2VGH 2VPF 3BDY 3P9W 3QTK 3S1B 3S1K 3V2A 4DEQ 4GLN 4GLS 4KZN 4QAF 4WPB 4ZFF 5HHC 5FV1 5FV2 5HHD 5DN2IdentifikatoriSimvoliVEGFA MVCD1 VEGF VPF vascular endothelial growth factor AZovnishni ID OMIM 192240 MGI 103178 HomoloGene 2534 GeneCards VEGFAReaguye na spolukuBrolucizumab 1 Ontologiya genaMolekulyarna funkciya heparin binding extracellular matrix binding cytokine activity growth factor activity neuropilin binding vascular endothelial growth factor receptor 2 binding receptor ligand activity vascular endothelial growth factor receptor 1 binding protein homodimerization activity platelet derived growth factor receptor binding GO 0001948 GO 0016582 protein binding vascular endothelial growth factor receptor binding fibronectin binding chemoattractant activity identical protein binding protein heterodimerization activityKlitinna komponenta citoplazma membrana extracellular region cell surface secretory granule platelet alpha granule lumen extracellular space GO 0005578 Pozaklitinna matricyaBiologichnij proces cardiac vascular smooth muscle cell development positive regulation of protein phosphorylation positive regulation of MAP kinase activity vascular endothelial growth factor signaling pathway positive regulation of receptor internalization outflow tract morphogenesis mammary gland alveolus development monocyte differentiation cell migration involved in sprouting angiogenesis vaskulogenez positive regulation of retinal ganglion cell axon guidance vascular endothelial growth factor receptor signaling pathway positive regulation of vascular permeability positive regulation of mesenchymal cell proliferation Angiogenez positive regulation of blood vessel endothelial cell migration positive regulation of ERK1 and ERK2 cascade mesoderm development positive regulation of positive chemotaxis positive regulation of p38MAPK cascade positive regulation of neuroblast proliferation dopaminergic neuron differentiation positive regulation of branching involved in ureteric bud morphogenesis kidney development lung development coronary artery morphogenesis in utero embryonic development cell maturation commissural neuron axon guidance positive regulation of peptidyl serine phosphorylation positive regulation of CREB transcription factor activity basophil chemotaxis artery morphogenesis regulation of transcription from RNA polymerase II promoter in response to hypoxia positive regulation of peptidyl tyrosine autophosphorylation positive regulation of peptidyl tyrosine phosphorylation branching involved in blood vessel morphogenesis positive regulation of protein localization to early endosome primitive erythrocyte differentiation positive regulation of protein kinase D signaling laktaciya Diferenciaciya klitin epithelial cell differentiation positive regulation of leukocyte migration positive regulation of epithelial cell proliferation negative regulation of apoptotic process GO 1901227 negative regulation of transcription by RNA polymerase II nejrobiologiya rozvitku macrophage differentiation positive regulation of angiogenesis regulation of retinal ganglion cell axon guidance lymph vessel morphogenesis post embryonic camera type eye development regulation of cell shape ovarian follicle development branching morphogenesis of an epithelial tube coronary vein morphogenesis surfactant homeostasis positive regulation of vascular endothelial growth factor receptor signaling pathway negative regulation of cysteine type endopeptidase activity involved in apoptotic process response to hypoxia positive regulation of endothelial cell proliferation positive regulation of protein containing complex assembly positive regulation of protein kinase C signaling positive regulation of cell migration heart morphogenesis platelet degranulation positive regulation of axon extension involved in axon guidance positive regulation of endothelial cell migration multicellular organism development positive regulation of histone deacetylase activity tube formation GO 1901313 positive regulation of gene expression positive regulation of protein autophosphorylation endothelial cell chemotaxis positive regulation of cell proliferation by VEGF activated platelet derived growth factor receptor signaling pathway positive regulation of endothelial cell chemotaxis by VEGF activated vascular endothelial growth factor receptor signaling pathway eye photoreceptor cell development positive regulation of transcription from RNA polymerase II promoter in response to hypoxia positive regulation of focal adhesion assembly cellular response to vascular endothelial growth factor stimulus activation of protein kinase activity positive regulation of cell division camera type eye morphogenesis GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II positive regulation of cell adhesion cellular response to hypoxia positive chemotaxis GO 0044324 GO 0003256 GO 1901213 GO 0046019 GO 0046020 GO 1900094 GO 0061216 GO 0060994 GO 1902064 GO 0003258 GO 0072212 regulation of transcription by RNA polymerase II positive regulation of cell population proliferation induction of positive chemotaxis positive regulation of mast cell chemotaxis motor neuron migration positive regulation of tyrosine phosphorylation of STAT protein rist VEGF activated neuropilin signaling pathway positive regulation of phosphorylation regulation of signaling receptor activity negative regulation of gene expression cytokine mediated signaling pathway positive regulation of cell migration involved in sprouting angiogenesis cellular stress response to acid chemical positive regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis positive regulation of sprouting angiogenesis positive regulation of DNA biosynthetic process sprouting angiogenesis regulation of nitric oxide mediated signal transduction positive regulation of cold induced thermogenesis GO 0072468 Signalna transdukciyaDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez7422 22339Ensembl ENSG00000112715 ENSMUSG00000023951UniProt P15692 Q00731RefSeq mRNK NM 003376NM 001025366NM 001025367NM 001025368NM 001025369NM 001025370NM 001033756NM 001171622NM 001171623NM 001171624NM 001171625NM 001171626NM 001171627NM 001171628NM 001171629NM 001171630NM 001204384NM 001204385NM 001287044NM 001317010NM 001025250NM 001025257NM 001110266NM 001110267NM 001110268NM 001287056NM 001287057NM 001287058NM 009505NM 001317041RefSeq bilok NP 001020537NP 001020538NP 001020539NP 001020540NP 001020541NP 001028928NP 001165093NP 001165094NP 001165095NP 001165096NP 001165097NP 001165098NP 001165099NP 001165100NP 001165101NP 001191313NP 001191314NP 001273973NP 001303939NP 003367NP 001020421NP 001020428NP 001103736NP 001103737NP 001103738NP 001273985NP 001273986NP 001273987NP 001303970NP 033531Lokus UCSC Hr 6 43 77 43 79 MbHr 17 46 33 46 34 MbPubMed search 2 3 VikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSLPGPHPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRRA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do faktoriv rostu mitogeniv bilkiv rozvitku Zadiyanij u takih biologichnih procesah yak angiogenez diferenciaciya klitin alternativnij splajsing Bilok maye sajt dlya zv yazuvannya z molekuloyu geparinu Sekretovanij nazovni Literatura red Leung D W Cachianes G Kuang W J Goeddel D V Ferrara N 1989 Vascular endothelial growth factor is a secreted angiogenic mitogen Science 246 1306 1309 PubMed DOI 10 1126 science 2479986 Weindel K Marme D Weich H A 1992 AIDS associated Kaposi s sarcoma cells in culture express vascular endothelial growth factor Biochem Biophys Res Commun 183 1167 1174 PubMed DOI 10 1016 S0006 291X 05 80313 4 Lei J Jiang A Pei D 1998 Identification and characterization of a new splicing variant of vascular endothelial growth factor VEGF183 Biochim Biophys Acta 1443 400 406 PubMed DOI 10 1016 S0167 4781 98 00240 1 Whittle C J Gillespie K M Harrison R Mathieson P W Harper S J 1999 Heterogeneous vascular endothelial growth factor VEGF isoform mRNA and receptor mRNA expression in human glomeruli and the identification of VEGF148 mRNA a novel truncated splice variant Clin Sci 97 303 312 PubMed DOI 10 1042 cs0970303 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PubMed DOI 10 1101 gr 2596504 Zhang Z Henzel W J 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites Protein Sci 13 2819 2824 PubMed DOI 10 1110 ps 04682504Primitki red Spoluki yaki fizichno vzayemodiyut z vascular endothelial growth factor A pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 12680 angl Arhiv originalu za 6 lipnya 2017 Procitovano 6 veresnya 2017 UniProt P15692 angl Arhiv originalu za 8 serpnya 2017 Procitovano 6 veresnya 2017 Div takozh red Hromosoma 6 nbsp Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Otrimano z https uk wikipedia org w index php title VEGFA amp oldid 40604699
