SMIM1 angl Small integral membrane protein 1 Vel blood group bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na 1 j hromosomi 3 Dovzhina polipeptidnogo lancyuga bilka stanovit 78 aminokislot a molekulyarna masa 8 749 4 SMIM1IdentifikatoriSimvoliSMIM1 Vel small integral membrane protein 1 Vel blood group Zovnishni ID OMIM 615242 MGI 1916109 HomoloGene 130039 GeneCards SMIM1OrtologiVidi Lyudina MishaEntrez388588 68859Ensembl ENSG00000235169 ENSMUSG00000078350UniProt B2RUZ4 P0C8K7RefSeq mRNK NM 001288583NM 001163724NM 001379690NM 001379691NM 001033144NM 001163721NM 001163722NM 001357248RefSeq bilok NP 001157196NP 001275512NP 001366619NP 001366620NP 001157193NP 001157194NP 001344177Lokus UCSC Hr 1 3 77 3 78 MbHr 4 154 1 154 11 MbPubMed search 1 2 VikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050MQPQESHVHYSRWEDGSRDGVSLGAVSSTEEASRCRRISQRLCTGKLGIAMKVLGGVALFWIIFILGYLTGYYVHKCKA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do fosfoproteyiniv Zadiyanij u takomu biologichnomu procesi yak acetilyuvannya Lokalizovanij u klitinnij membrani membrani Literatura red The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PubMed DOI 10 1101 gr 2596504 Arnaud L Kelley L P Helias V Cartron J P Ballif B A 2015 SMIM1 is a type II transmembrane phosphoprotein and displays the Vel blood group antigen at its carboxyl terminus FEBS Lett 589 3624 3630 PubMed DOI 10 1016 j febslet 2015 09 029Primitki red Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 44204 angl Procitovano 18 veresnya 2017 UniProt B2RUZ4 angl Arhiv originalu za 7 zhovtnya 2017 Procitovano 18 veresnya 2017 Div takozh red Hromosoma 1 nbsp Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Otrimano z https uk wikipedia org w index php title SMIM1 amp oldid 36497082
