S100A3 angl S100 calcium binding protein A3 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 1 yi hromosomi 3 Dovzhina polipeptidnogo lancyuga bilka stanovit 101 aminokislot a molekulyarna masa 11 713 4 S100A3Nayavni strukturiPDBPoshuk ortologiv PDBe RCSBSpisok kodiv PDB1KSO 3NSI 3NSK 3NSL 3NSOIdentifikatoriSimvoliS100A3 S100E S100 calcium binding protein A3Zovnishni ID OMIM 176992 MGI 1338849 HomoloGene 2223 GeneCards S100A3Shablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez6274 20197Ensembl ENSG00000188015 ENSMUSG00000001021UniProt P33764 P62818RefSeq mRNK NM 002960NM 011310NM 001355597NM 001355600NM 001355602RefSeq bilok NP 002951NP 035440NP 001342526NP 001342529NP 001342531Lokus UCSC Hr 1 153 55 153 55 MbHr 3 90 49 90 51 MbPubMed search 1 2 VikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050MARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMSVLDTNKDCEVDFVEYVRSLACLCLYCHEYFKDCPSEPPCSQA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Zadiyanij u takomu biologichnomu procesi yak polimorfizm Bilok maye sajt dlya zv yazuvannya z ionami metaliv ionom cinku ionom kalciyu Lokalizovanij u citoplazmi Literatura red Engelkamp D Schaefer B W Mattei M G Erne P Heizmann C W 1993 Six S100 genes are clustered on human chromosome 1q21 identification of two genes coding for the two previously unreported calcium binding proteins S100D and S100E Proc Natl Acad Sci U S A 90 6547 6551 PubMed DOI 10 1073 pnas 90 14 6547 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PubMed DOI 10 1101 gr 2596504 Fritz G Heizmann C W Kroneck P M H 1998 Probing the structure of the human Ca2 and Zn2 binding protein S100A3 spectroscopic investigations of its transition metal ion complexes and three dimensional structural model Biochim Biophys Acta 1448 264 276 PubMed DOI 10 1016 S0167 4889 98 00138 4 Unno M Kawasaki T Takahara H Heizmann C W Kizawa K 2011 Refined crystal structures of human Ca 2 Zn 2 binding S100A3 protein characterized by two disulfide bridges J Mol Biol 408 477 490 PubMed DOI 10 1016 j jmb 2011 02 055Primitki red Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 10493 angl Procitovano 25 serpnya 2017 UniProt P33764 angl Arhiv originalu za 30 lipnya 2016 Procitovano 25 serpnya 2017 Div takozh red Hromosoma 1 nbsp Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Otrimano z https uk wikipedia org w index php title S100A3 amp oldid 38132822