www.wikidata.uk-ua.nina.az
RNASE2 angl Ribonuclease A family member 2 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 14 yi hromosomi 3 Dovzhina polipeptidnogo lancyuga bilka stanovit 161 aminokislot a molekulyarna masa 18 354 4 RNASE2Nayavni strukturiPDBPoshuk ortologiv PDBe RCSBSpisok kodiv PDB1GQV 1HI2 1HI3 1HI4 1HI5 1K2A 2BEX 2BZZ 2C01 2C02 2C05 5E13IdentifikatoriSimvoliRNASE2 EDN RAF3 RNS2 ribonuclease A family member 2Zovnishni ID OMIM 131410 MGI 1858598 HomoloGene 121614 GeneCards RNASE2Ontologiya genaMolekulyarna funkciya nuclease activity endonuclease activity hydrolase activity ribonuclease A activity nucleic acid binding lipopolysaccharide binding ribonuclease activity lyase activityKlitinna komponenta extracellular region lizosoma ekzosoma azurophil granule lumenBiologichnij proces hemotaksis Degradaciya RNK RNA phosphodiester bond hydrolysis endonucleolytic positive regulation of protein targeting to mitochondrion neutrophil degranulation induction of bacterial agglutination GO 0051636 defense response to Gram negative bacterium GO 0051637 defense response to Gram positive bacterium RNA phosphodiester bond hydrolysisDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez6036 54159Ensembl ENSG00000169385 ENSMUSG00000059606UniProt P10153 O35292RefSeq mRNK NM 002934NM 019398RefSeq bilok NP 002925NP 062271Lokus UCSC Hr 14 20 96 20 96 MbHr 14 51 4 51 4 MbPubMed search 1 2 VikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050MVPKLFTSQICLLLLLGLLAVEGSLHVKPPQFTWAQWFETQHINMTSQQCTNAMQVINNYQRRCKNQNTFLLTTFANVVNVCGNPNMTCPSNKTRKNCHHSGSQVPLIHCNLTTPSPQNISNCRYAQTPANMFYIVACDNRDQRRDPPQYPVVPVHLDRIIA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do gidrolaz nukleaz endonukleaz Zadiyanij u takomu biologichnomu procesi yak hemotaksis Lokalizovanij u lizosomi Literatura red Hamann K J Barker R L Loegering D A Pease L R Gleich G J 1989 Sequence of human eosinophil derived neurotoxin cDNA identity of deduced amino acid sequence with human nonsecretory ribonucleases Gene 83 161 167 PubMed DOI 10 1016 0378 1119 89 90414 9 Rosenberg H F Tenen D G Ackerman S J 1989 Molecular cloning of the human eosinophil derived neurotoxin a member of the ribonuclease gene family Proc Natl Acad Sci U S A 86 4460 4464 PubMed DOI 10 1073 pnas 86 12 4460 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PubMed DOI 10 1101 gr 2596504 Kardana A Bagshawe K D Coles B Read D Taylor M 1993 Characterisation of UGP and its relationship with beta core fragment Br J Cancer 67 686 692 PubMed DOI 10 1038 bjc 1993 127 de Beer T Vliegenthart J F G Loeffler A Hofsteenge J 1995 The hexopyranosyl residue that is C glycosidically linked to the side chain of tryptophan 7 in human RNase Us is alpha mannopyranose Biochemistry 34 11785 11789 PubMed DOI 10 1021 bi00037a016 Teufel D P Kao R Y Acharya K R Shapiro R 2003 Mutational analysis of the complex of human RNase inhibitor and human eosinophil derived neurotoxin RNase 2 Biochemistry 42 1451 1459 PubMed DOI 10 1021 bi026852oPrimitki red Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 10045 angl Procitovano 11 veresnya 2017 UniProt P10153 angl Arhiv originalu za 14 veresnya 2017 Procitovano 11 veresnya 2017 Div takozh red Hromosoma 14 nbsp Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Na cyu stattyu ne posilayutsya inshi statti Vikipediyi Bud laska skoristajtesya pidkazkoyu ta rozstavte posilannya vidpovidno do prijnyatih rekomendacij Otrimano z https uk wikipedia org w index php title RNASE2 amp oldid 35714033