RLN2 angl Relaxin 2 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na 9 j hromosomi 2 Dovzhina polipeptidnogo lancyuga bilka stanovit 185 aminokislot a molekulyarna masa 21 043 3 RLN2Nayavni strukturiPDBPoshuk dlya lyudej PDBe RCSBSpisok kodiv PDB2MV1 6RLXIdentifikatoriSimvoliRLN2 H2 H2 RLX RLXH2 bA12D24 1 1 bA12D24 1 2 relaxin 2Zovnishni ID OMIM 179740 HomoloGene 129864 GeneCards RLN2Ontologiya genaMolekulyarna funkciya hormone activityKlitinna komponenta extracellular regionBiologichnij proces female pregnancy GO 1901313 positive regulation of gene expression positive regulation of angiogenesis GO 0048552 regulation of catalytic activity regulation of signaling receptor activity G protein coupled receptor signaling pathwayDzherela Amigo QuickGOOrtologiVidi Lyudina MishaEntrez6019 n dEnsembl ENSG00000107014 n dUniProt P04090 n dRefSeq mRNK NM 005059NM 134441NM 001329191n dRefSeq bilok NP 001316120NP 005050NP 604390n dLokus UCSC Hr 9 5 3 5 3 Mbn dPubMed search 1 n dVikidaniDiv Red dlya lyudej Poslidovnist aminokislot1020304050MPRLFFFHLLGVCLLLNQFSRAVADSWMEEVIKLCGRELVRAQIAICGMSTWSKRSLSQEDAPQTPRPVAEIVPSFINKDTETINMMSEFVANLPQELKLTLSEMQPALPQLQQHVPVLKDSSLLFEEFKKLIRNRQSEAADSSPSELKYLGLDTHSRKKRQLYSALANKCCHVGCTKRSLARFCA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do gormoniv Zadiyanij u takomu biologichnomu procesi yak alternativnij splajsing Sekretovanij nazovni Literatura red The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PubMed DOI 10 1101 gr 2596504 Gunnersen J M Fu P Roche P J Tregear G W 1996 Expression of human relaxin genes characterization of a novel alternatively spliced human relaxin mRNA species Mol Cell Endocrinol 118 85 94 PubMed DOI 10 1016 0303 7207 96 03770 7 Garibay Tupas J L Csiszar K Fox M Povey S Bryant Greenwood G D 1999 Analysis of the 5 upstream regions of the human relaxin H1 and H2 genes and their chromosomal localization on chromosome 9p24 1 by radiation hybrid and breakpoint mapping J Mol Endocrinol 23 355 365 PubMed DOI 10 1677 jme 0 0230355 Winslow J W Griffin P R Rinderknecht E Vandlen R L 1990 Structural characterization by mass spectrometry of native and recombinant human relaxin Biomed Environ Mass Spectrom 19 655 664 PubMed DOI 10 1002 bms 1200191105 Buellesbach E E Schwabe C 1991 Total synthesis of human relaxin and human relaxin derivatives by solid phase peptide synthesis and site directed chain combination J Biol Chem 266 10754 10761 PubMedPrimitki red Human PubMed Reference HUGO Gene Nomenclature Commitee HGNC 10027 angl Procitovano 19 veresnya 2017 UniProt P04090 angl Arhiv originalu za 8 serpnya 2017 Procitovano 19 veresnya 2017 Div takozh red Hromosoma 9 nbsp Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Na cyu stattyu ne posilayutsya inshi statti Vikipediyi Bud laska skoristajtesya pidkazkoyu ta rozstavte posilannya vidpovidno do prijnyatih rekomendacij Otrimano z https uk wikipedia org w index php title RLN2 amp oldid 35713854