www.wikidata.uk-ua.nina.az

RCC1 англ Regulator of chromosome condensation 1 білок який кодується однойменним геном розташованим у людей на коротком

RCC1

RCC1 (англ. Regulator of chromosome condensation 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. Довжина поліпептидного ланцюга білка становить 421 амінокислот, а молекулярна маса — 44 969.

RCC1
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи RCC1, CHC1, RCC1-I, SNHG3-regulator of chromosome condensation 1
Зовнішні ІД OMIM: 179710 MGI: 1913989 HomoloGene: 55567 GeneCards: RCC1
Ортологи
Види Людина Миша
Entrez
1104
100088
Ensembl
UniProt
RefSeq (мРНК)
RefSeq (білок)
Локус (UCSC) Хр. 1: 28.51 – 28.54 Mb Хр. 4: 132.06 – 132.08 Mb
PubMed search
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MSPKRIAKRRSPPADAIPKSKKVKVSHRSHSTEPGLVLTLGQGDVGQLGL
GENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDEGALG
RDTSVEGSEMVPGKVELQEKVVQVSAGDSHTAALTDDGRVFLWGSFRDNN
GVIGLLEPMKKSMVPVQVQLDVPVVKVASGNDHLVMLTADGDLYTLGCGE
QGQLGRVPELFANRGGRQGLERLLVPKCVMLKSRGSRGHVRFQDAFCGAY
FTFAISHEGHVYGFGLSNYHQLGTPGTESCFIPQNLTSFKNSTKSWVGFS
GGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSV
ACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRV
VLSVSSGGQHTVLLVKDKEQS

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах як клітинний цикл, поділ клітини, мітоз. Білок має сайт для зв'язування з ДНК. Локалізований у цитоплазмі, ядрі.

Література Редагувати

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Bischoff F.R., Maier G., Tilz G., Ponstingl H. (1990). A 47-kDa human nuclear protein recognized by antikinetochore autoimmune sera is homologous with the protein encoded by RCC1, a gene implicated in onset of chromosome condensation.. Proc. Natl. Acad. Sci. U.S.A. 87: 8617 — 8621.  PubMed DOI:10.1073/pnas.87.21.8617
  • Bischoff F.R., Ponstingl H. (1991). Catalysis of guanine nucleotide exchange on Ran by the mitotic regulator RCC1.. Nature 354: 80 — 82.  PubMed DOI:10.1038/354080a0
  • Neuhaus E.M., Mashukova A., Barbour J., Wolters D., Hatt H. (2006). Novel function of beta-arrestin2 in the nucleus of mature spermatozoa.. J. Cell Sci. 119: 3047 — 3056.  PubMed DOI:10.1242/jcs.03046
  • Hao Y., Macara I.G. (2008). Regulation of chromatin binding by a conformational switch in the tail of the Ran exchange factor RCC1.. J. Cell Biol. 182: 827 — 836.  PubMed DOI:10.1083/jcb.200803110
  • Renault L., Kuhlmann J., Henkel A., Wittinghofer A. (2001). Structural basis for guanine nucleotide exchange on Ran by the regulator of chromosome condensation (RCC1).. Cell 105: 245 — 255.  PubMed DOI:10.1016/S0092-8674(01)00315-4

Примітки Редагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:1913 (англ.). Процитовано 25 серпня 2017. 
  4. (англ.). Архів оригіналу за 17 серпня 2017. Процитовано 25 серпня 2017. 

Див. також Редагувати

Це незавершена стаття про білки.
Ви можете допомогти проєкту, виправивши або дописавши її.
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри
Дата публікації:
RCC1 angl Regulator of chromosome condensation 1 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 1 yi hromosomi 3 Dovzhina polipeptidnogo lancyuga bilka stanovit 421 aminokislot a molekulyarna masa 44 969 4 RCC1Nayavni strukturiPDBPoshuk ortologiv PDBe RCSBSpisok kodiv PDB1A12 1I2M 5E1O 5E2A 5E1M 5E2B 5E1D 5E1BIdentifikatoriSimvoliRCC1 CHC1 RCC1 I SNHG3 regulator of chromosome condensation 1Zovnishni ID OMIM 179710 MGI 1913989 HomoloGene 55567 GeneCards RCC1Ontologiya genaMolekulyarna funkciya DNA binding guanyl nucleotide exchange factor activity GO 0031493 histone binding chromatin binding GO 0001948 GO 0016582 protein binding nucleosomal DNA binding nucleosome binding sulfate binding protein heterodimerization activityKlitinna komponenta citoplazma Yaderna membrana Nukleoplazma condensed nuclear chromosome klitinne yadro Hromatin hromosoma GO 0009327 protein containing complexBiologichnij proces chromosome segregation G1 phase GO 0043148 mitotic spindle organization podil klitini spindle assembly klitinnij cikl GO 0022415 viral process regulation of mitotic nuclear division protein heterotetramerization regulation of molecular function G1 S transition of mitotic cell cycleDzherela Amigo QuickGOOrtologiVidi Lyudina MishaEntrez1104 100088Ensembl ENSG00000180198 ENSMUSG00000028896UniProt P18754Q5T081 Q8VE37RefSeq mRNK NM 001048194NM 001048195NM 001048199NM 001269NM 001381865NM 001381866NM 001197082NM 133878RefSeq bilok NP 001041659NP 001041660NP 001041664NP 001260NP 001368794NP 001368795NP 001041664 1NP 001260 1NP 001184011NP 598639Lokus UCSC Hr 1 28 51 28 54 MbHr 4 132 06 132 08 MbPubMed search 1 2 VikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050MSPKRIAKRRSPPADAIPKSKKVKVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQEKVVQVSAGDSHTAALTDDGRVFLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDVPVVKVASGNDHLVMLTADGDLYTLGCGEQGQLGRVPELFANRGGRQGLERLLVPKCVMLKSRGSRGHVRFQDAFCGAYFTFAISHEGHVYGFGLSNYHQLGTPGTESCFIPQNLTSFKNSTKSWVGFSGGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSVACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKDKEQSA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak klitinnij cikl podil klitini mitoz Bilok maye sajt dlya zv yazuvannya z DNK Lokalizovanij u citoplazmi yadri Literatura RedaguvatiThe status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PubMed DOI 10 1101 gr 2596504 Bischoff F R Maier G Tilz G Ponstingl H 1990 A 47 kDa human nuclear protein recognized by antikinetochore autoimmune sera is homologous with the protein encoded by RCC1 a gene implicated in onset of chromosome condensation Proc Natl Acad Sci U S A 87 8617 8621 PubMed DOI 10 1073 pnas 87 21 8617 Bischoff F R Ponstingl H 1991 Catalysis of guanine nucleotide exchange on Ran by the mitotic regulator RCC1 Nature 354 80 82 PubMed DOI 10 1038 354080a0 Neuhaus E M Mashukova A Barbour J Wolters D Hatt H 2006 Novel function of beta arrestin2 in the nucleus of mature spermatozoa J Cell Sci 119 3047 3056 PubMed DOI 10 1242 jcs 03046 Hao Y Macara I G 2008 Regulation of chromatin binding by a conformational switch in the tail of the Ran exchange factor RCC1 J Cell Biol 182 827 836 PubMed DOI 10 1083 jcb 200803110 Renault L Kuhlmann J Henkel A Wittinghofer A 2001 Structural basis for guanine nucleotide exchange on Ran by the regulator of chromosome condensation RCC1 Cell 105 245 255 PubMed DOI 10 1016 S0092 8674 01 00315 4Primitki Redaguvati Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 1913 angl Procitovano 25 serpnya 2017 UniProt P18754 angl Arhiv originalu za 17 serpnya 2017 Procitovano 25 serpnya 2017 Div takozh RedaguvatiHromosoma 1 nbsp Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Otrimano z https uk wikipedia org w index php title RCC1 amp oldid 35712894