PDCD10 angl Programmed cell death 10 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 3 yi hromosomi 3 Dovzhina polipeptidnogo lancyuga bilka stanovit 212 aminokislot a molekulyarna masa 24 702 4 PDCD10Nayavni strukturiPDBPoshuk ortologiv PDBe RCSBSpisok kodiv PDB3AJM 3L8I 3L8J 3RQE 3RQF 3RQG 3W8H 3W8I 4GEH 4TVQIdentifikatoriSimvoliPDCD10 CCM3 TFAR15 programmed cell death 10Zovnishni ID OMIM 609118 MGI 1928396 HomoloGene 10505 GeneCards PDCD10Ontologiya genaMolekulyarna funkciya protein homodimerization activity protein N terminus binding GO 0001948 GO 0016582 protein binding protein kinase bindingKlitinna komponenta citoplazma gialoplazma kompleks Goldzhi membrana Golgi membrane klitinna membrana ekzosomaBiologichnij proces intrinsic apoptotic signaling pathway in response to hydrogen peroxide positive regulation of MAP kinase activity positive regulation of cell migration protein stabilization negative regulation of apoptotic process negative regulation of gene expression establishment of Golgi localization stress fiber assembly positive regulation of peptidyl serine phosphorylation positive regulation of protein serine threonine kinase activity Golgi reassembly negative regulation of cell migration involved in sprouting angiogenesis GO 1901313 positive regulation of gene expression Angiogenez positive regulation of cell population proliferation negative regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis regulation of Rho protein signal transduction response to hydrogen peroxide wound healing spreading of cells positive regulation of Notch signaling pathway positive regulation of stress activated MAPK cascade GO 0097285 apoptoz positive regulation of intracellular protein transport cellular response to leukemia inhibitory factorDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez11235 56426Ensembl ENSG00000114209 ENSMUSG00000027835UniProt Q9BUL8 Q8VE70RefSeq mRNK NM 007217NM 145859NM 145860NM 019745RefSeq bilok NP 009148NP 665858NP 665859NP 062719Lokus UCSC Hr 3 167 68 167 73 MbHr 3 75 42 75 46 MbPubMed search 1 2 VikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050MRMTMEEMKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKTVAA Alanin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin Y Tirozin Zadiyanij u takih biologichnih procesah yak apoptoz angiogenez polimorfizm acetilyaciya Lokalizovanij u klitinnij membrani citoplazmi membrani aparati goldzhi Literatura red The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PubMed DOI 10 1101 gr 2596504 Mardakheh F K Self A Marshall C J 2016 RHO binding to FAM65A regulates Golgi reorientation during cell migration J Cell Sci 129 4466 4479 PubMed DOI 10 1242 jcs 198614 Wang Y G Liu H T Ma D L Zhang Y M 1999 cDNA cloning and expression of an apoptosis related gene human TFAR 15 gene Sci China Ser C Life Sci 42 323 329 Primitki red Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 8761 angl Arhiv originalu za 3 chervnya 2016 Procitovano 30 serpnya 2017 UniProt Q9BUL8 angl Arhiv originalu za 27 sichnya 2018 Procitovano 30 serpnya 2017 Div takozh red Hromosoma 3 nbsp Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Otrimano z https uk wikipedia org w index php title PDCD10 amp oldid 35692520