ICAM4 angl Intercellular adhesion molecule 4 Landsteiner Wiener blood group bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 19 yi hromosomi 3 Dovzhina polipeptidnogo lancyuga bilka stanovit 271 aminokislot a molekulyarna masa 29 265 4 ICAM4IdentifikatoriSimvoliICAM4 CD242 LW intercellular adhesion molecule 4 Landsteiner Wiener blood group Zovnishni ID OMIM 614088 MGI 1925619 HomoloGene 74401 GeneCards ICAM4Ontologiya genaMolekulyarna funkciya integrin binding GO 0001948 GO 0016582 protein bindingKlitinna komponenta integral component of membrane extracellular region klitinna membrana integral component of plasma membrane membranaBiologichnij proces adgeziya klitin extracellular matrix organization regulation of immune response cell cell adhesionDzherela Amigo QuickGOOrtologiVidi Lyudina MishaEntrez3386 78369Ensembl ENSG00000105371 ENSMUSG00000001014UniProt Q14773 Q9ERM2RefSeq mRNK NM 022377NM 001039132NM 001544NM 023892NM 001364509RefSeq bilok NP 001034221NP 001535NP 076381NP 001351438Lokus UCSC Hr 19 10 29 10 29 MbHr 9 20 94 20 94 MbPubMed search 1 2 VikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050MGSLFPLSLLFFLAAAYPGVGSALGRRTKRAQSPKGSPLAPSGTSVPFWVRMSPEFVAVQPGKSVQLNCSNSCPQPQNSSLRTPLRQGKTLRGPGWVSYQLLDVRAWSSLAHCLVTCAGKTRWATSRITAYKPPHSVILEPPVLKGRKYTLRCHVTQVFPVGYLVVTLRHGSRVIYSESLERFTGLDLANVTLTYEFAAGPRDFWQPVICHARLNLDGLVVRNSSAPITLMLAWSPAPTALASGSIAALVGILLTVGAAYLCKCLAMKSQAA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Zadiyanij u takih biologichnih procesah yak klitinna adgeziya alternativnij splajsing Lokalizovanij u klitinnij membrani membrani Takozh sekretovanij nazovni Literatura red The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PubMed DOI 10 1101 gr 2596504 Hermand P le Pennec P Y Rouger P Cartron J P Bailly P 1996 Characterization of the gene encoding the human LW blood group protein in LW and LW phenotypes Blood 87 2962 2967 PubMedPrimitki red Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 5347 angl Procitovano 21 veresnya 2017 UniProt Q14773 angl Arhiv originalu za 19 serpnya 2016 Procitovano 21 veresnya 2017 Div takozh red Hromosoma 19 nbsp Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Otrimano z https uk wikipedia org w index php title ICAM4 amp oldid 36497163