GDNF angl Glial cell derived neurotrophic factor bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 5 yi hromosomi 4 Dovzhina polipeptidnogo lancyuga bilka stanovit 211 aminokislot a molekulyarna masa 23 720 5 GDNFNayavni strukturiPDBPoshuk ortologiv PDBe RCSBSpisok kodiv PDB2V5E 3FUB 4UX8IdentifikatoriSimvoliGDNF ATF1 ATF2 HFB1 HSCR3 glial cell derived neurotrophic factor ATFZovnishni ID OMIM 600837 HomoloGene 433 GeneCards GDNFPov yazani genetichni zahvoryuvannyafeohromocitoma 1 Ontologiya genaMolekulyarna funkciya protein homodimerization activity GO 0001948 GO 0016582 protein binding growth factor activity signaling receptor binding chemoattractant activity involved in axon guidanceKlitinna komponenta extracellular region vnutrishnoklitinnij extracellular spaceBiologichnij proces Peristaltika ureteric bud development regulation of dopamine uptake involved in synaptic transmission peripheral nervous system development sympathetic nervous system development organ induction adult locomotory behavior positive regulation of mesenchymal to epithelial transition involved in metanephros morphogenesis regulation of stem cell differentiation regulation of morphogenesis of a branching structure mesenchymal to epithelial transition involved in metanephros morphogenesis negative regulation of apoptotic process nejrobiologiya rozvitku positive regulation of monooxygenase activity enteric nervous system development mRNA stabilization branching involved in ureteric bud morphogenesis postganglionic parasympathetic fiber development positive regulation of dopamine secretion neural crest cell migration postsynaptic membrane organization positive regulation of cell population proliferation positive regulation of cell differentiation positive regulation of ureteric bud formation ureteric bud formation Regulyaciya ekspresiyi geniv negative regulation of extrinsic apoptotic signaling pathway in absence of ligand metanephros development neuron projection development GO 0072468 Signalna transdukciya GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II MAPK cascade axon guidance GO 1904089 negative regulation of neuron apoptotic process positive regulation of branching involved in ureteric bud morphogenesis regulation of signaling receptor activity dorsal spinal cord development embryonic organ development chemoattraction of axon commissural neuron axon guidance regulation of semaphorin plexin signaling pathwayDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez2668 25453Ensembl ENSG00000168621 ENSRNOG00000012819UniProt P39905 Q07731RefSeq mRNK NM 000514NM 001190468NM 001190469NM 001278098NM 199231NM 199234NM 019139RefSeq bilok NP 000505NP 001177397NP 001177398NP 001265027NP 954701NP 062012NP 001388709Lokus UCSC Hr 5 37 81 37 84 Mbn dPubMed search 2 3 VikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050MKLWDVVAVCLVLLHTASAFPLPAGKRPPEAPAEDRSLGRRRAPFALSSDSNMPEDYPDQFDDVMDFIQATIKRLKRSPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCIA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do faktoriv rostu Zadiyanij u takih biologichnih procesah yak polimorfizm alternativnij splajsing Sekretovanij nazovni Literatura RedaguvatiLin L F H Doherty D H Lile J D Bektesh S Collins F 1993 GDNF a glial cell line derived neurotrophic factor for midbrain dopaminergic neurons Science 260 1130 1132 PubMed DOI 10 1126 science 8493557 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PubMed DOI 10 1101 gr 2596504 Baecker P A Lee W H Verity A N Eglen R M Johnson R M 1999 Characterization of a promoter for the human glial cell line derived neurotrophic factor gene Brain Res Mol Brain Res 69 209 222 PubMed DOI 10 1016 S0169 328X 99 00106 0 Parkash V Goldman A 2009 Comparison of GFL GFRalpha complexes further evidence relating GFL bend angle to RET signalling Acta Crystallogr F 65 551 558 PubMed DOI 10 1107 S1744309109017722 Ivanchuk S M Myers S M Eng C Mulligan L M 1996 De novo mutation of GDNF ligand for the RET GDNFR alpha receptor complex in Hirschsprung disease Hum Mol Genet 5 2023 2026 PubMed DOI 10 1093 hmg 5 12 2023 Angrist M Bolk S Halushka M Lapchak P A Chakravarti A 1996 Germline mutations in glial cell line derived neurotrophic factor GDNF and RET in a Hirschsprung disease patient Nat Genet 14 341 344 PubMed DOI 10 1038 ng1196 341Primitki Redaguvati Zahvoryuvannya genetichno pov yazani z GDNF pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 4232 angl Arhiv originalu za 23 bereznya 2016 Procitovano 31 serpnya 2017 UniProt P39905 angl Arhiv originalu za 16 serpnya 2017 Procitovano 31 serpnya 2017 Div takozh RedaguvatiHromosoma 5 nbsp Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Otrimano z https uk wikipedia org w index php title GDNF amp oldid 35617116