www.wikidata.uk-ua.nina.az
GCNT2 angl N acetyllactosaminide beta 1 6 N acetylglucosaminyl transferase bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 6 yi hromosomi 4 Dovzhina polipeptidnogo lancyuga bilka stanovit 402 aminokislot a molekulyarna masa 45 873 5 GCNT2IdentifikatoriSimvoliGCNT2 CCAT CTRCT13 GCNT2C GCNT5 IGNT II NACGT1 NAGCT1 ULG3 bA360O19 2 bA421M1 1 glucosaminyl N acetyl transferase 2 I branching enzyme I blood group glucosaminyl N acetyl transferase 2 I blood group Zovnishni ID OMIM 600429 MGI 1100870 HomoloGene 41535 GeneCards GCNT2Pov yazani genetichni zahvoryuvannyacataract 13 with adult i phenotype 1 Ontologiya genaMolekulyarna funkciya transferase activity glycosyltransferase activity acetylglucosaminyltransferase activity N acetyllactosaminide beta 1 6 N acetylglucosaminyltransferase activityKlitinna komponenta integral component of membrane Golgi membrane membrana komponent klitini kompleks GoldzhiBiologichnij proces negative regulation of cell substrate adhesion maintenance of lens transparency positive regulation of heterotypic cell cell adhesion positive regulation of cell migration glycosaminoglycan biosynthetic process multicellular organism development GO 0033578 GO 0033577 GO 0033575 GO 0033576 protein glycosylation transforming growth factor beta receptor signaling pathway positive regulation of cell population proliferation posttranscriptional regulation of gene expression positive regulation of epithelial to mesenchymal transition positive regulation of protein kinase B signaling positive regulation of ERK1 and ERK2 cascadeDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez2651 14538Ensembl ENSG00000111846ENSG00000285222 ENSMUSG00000021360UniProt Q8N0V5 P97402RefSeq mRNK NM 001491NM 145649NM 145655NM 001374747NM 008105NM 023887NM 133219RefSeq bilok NP 663624 1NP 001482 1NP 663630 2NP 001482NP 663624NP 663630NP 001361676NP 001482 1NP 663630 2NP 663624 1NP 032131NP 076376NP 573482Lokus UCSC Hr 6 10 49 10 63 MbHr 13 41 01 41 11 MbPubMed search 2 3 VikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050MMGSWKHCLFSASLISALIFVFVYNTELWENKRFLRAALSNASLLAEACHQIFEGKVFYPTENALKTTLDEATCYEYMVRSHYVTETLSEEEAGFPLAYTVTIHKDFGTFERLFRAIYMPQNVYCVHLDQKATDAFKGAVKQLLSCFPNAFLASKKESVVYGGISRLQADLNCLEDLVASEVPWKYVINTCGQDFPLKTNREIVQYLKGFKGKNITPGVLPPDHAVGRTKYVHQELLNHKNSYVIKTTKLKTPPPHDMVIYFGTAYVALTRDFANFVLQDQLALDLLSWSKDTYSPDEHFWVTLNRIPGVPGSMPNASWTGNLRAIKWSDMEDRHGGCHGHYVHGICIYGNGDLKWLVNSPSLFANKFELNTYPLTVECLELRHRERTLNQSETAIQPSWYFA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do transferaz glikoziltransferaz Zadiyanij u takomu biologichnomu procesi yak alternativnij splajsing Lokalizovanij u membrani aparati goldzhi Literatura red Bierhuizen M F A Mattei M G Fukuda M 1993 Expression of the developmental I antigen by a cloned human cDNA encoding a member of a beta 1 6 N acetylglucosaminyltransferase gene family Genes Dev 7 468 478 PubMed DOI 10 1101 gad 7 3 468 Bierhuizen M F A Maemura K Kudo S Fukuda M 1995 Genomic organization of core 2 and I branching beta 1 6 N acetylglucosaminyltransferases Implication for evolution of the beta 1 6 N acetylglucosaminyltransferase gene family Glycobiology 5 417 425 PubMed DOI 10 1093 glycob 5 4 417 Zhang T Haws P Wu Q 2004 Multiple variable first exons a mechanism for cell and tissue specific gene regulation Genome Res 14 79 89 PubMed DOI 10 1101 gr 1225204 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PubMed DOI 10 1101 gr 2596504 Yu L C Twu Y C Chang C Y Lin M 2001 Molecular basis of the adult i phenotype and the gene responsible for the expression of the human blood group I antigen Blood 98 3840 3845 PubMed DOI 10 1182 blood V98 13 3840Primitki red Zahvoryuvannya genetichno pov yazani z GCNT2 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 4204 angl Procitovano 6 veresnya 2017 UniProt Q06430 angl Arhiv originalu za 1 travnya 2016 Procitovano 6 veresnya 2017 Div takozh red Hromosoma 6 nbsp Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Otrimano z https uk wikipedia org w index php title GCNT2 amp oldid 36496747