EIF6 angl Eukaryotic translation initiation factor 6 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 20 yi hromosomi 3 Dovzhina polipeptidnogo lancyuga bilka stanovit 245 aminokislot a molekulyarna masa 26 599 4 EIF6IdentifikatoriSimvoliEIF6 CAB EIF3A ITGB4BP b 2 gcn eIF 6 p27 BBP p27BBP eukaryotic translation initiation factor 6Zovnishni ID OMIM 602912 MGI 1196288 HomoloGene 7135 GeneCards EIF6Ontologiya genaMolekulyarna funkciya ribosome binding GO 0001948 GO 0016582 protein binding translation initiation factor activity ribosomal large subunit bindingKlitinna komponenta citoplazma ekzosoma klitinne yadro Nukleoplazma yaderce gialoplazma preribosome large subunit precursor lamin filament Promizhni filamentiBiologichnij proces translational initiation mature ribosome assembly Biosintez bilkiv ribosome biogenesis response to insulin maturation of LSU rRNA gene silencing by miRNA regulation of glycolytic process assembly of large subunit precursor of preribosome maturation of 5 8S rRNA regulation of fatty acid biosynthetic process GO 1904489 regulation of reactive oxygen species metabolic process positive regulation of translation regulation of megakaryocyte differentiation miRNA mediated gene silencing by inhibition of translation ribosomal subunit export from nucleus ribosomal large subunit biogenesisDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez3692 16418Ensembl ENSG00000242372 ENSMUSG00000027613UniProt P56537 O55135RefSeq mRNK NM 001267810NM 002212NM 181466NM 181467NM 181468NM 181469NM 010579RefSeq bilok NP 001254739NP 002203NP 852131NP 852133NP 034709Lokus UCSC Hr 20 35 28 35 28 MbHr 2 155 66 155 67 MbPubMed search 1 2 VikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050MAVRASFENNCEIGCFAKLTNTYCLVAIGGSENFYSVFEGELSDTIPVVHASIAGCRIIGRMCVGNRHGLLVPNNTTDQELQHIRNSLPDTVQIRRVEERLSALGNVTTCNDYVALVHPDLDRETEEILADVLKVEVFRQTVADQVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVPLVAGTVNRGSEVIAAGMVVNDWCAFCGLDTTSTELSVVESVFKLNEAQPSTIATSMRDSLIDSLTA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do faktoriv iniciaciyi Zadiyanij u takih biologichnih procesah yak biosintez bilka biogenez ribosom Lokalizovanij u citoplazmi yadri Literatura red Si K Chaudhuri J Chevesich J Maitra U 1997 Molecular cloning and functional expression of a human cDNA encoding translation initiation factor 6 Proc Natl Acad Sci U S A 94 14285 14290 PubMed DOI 10 1073 pnas 94 26 14285 Donadini A Giodini A Sanvito F Marchisio P C Biffo S 2001 The human ITGB4BP gene is constitutively expressed in vitro but highly modulated in vivo Gene 266 35 43 PubMed DOI 10 1016 S0378 1119 01 00370 5 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PubMed DOI 10 1101 gr 2596504 Basu U Si K Deng H Maitra U 2003 Phosphorylation of mammalian eukaryotic translation initiation factor 6 and its Saccharomyces cerevisiae homologue Tif6p evidence that phosphorylation of Tif6p regulates its nucleocytoplasmic distribution and is required for yeast cell growth Mol Cell Biol 23 6187 6199 PubMed DOI 10 1128 MCB 23 17 6187 6199 2003Primitki red Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 6159 angl Arhiv originalu za 14 zhovtnya 2017 Procitovano 21 serpnya 2017 UniProt P56537 angl Arhiv originalu za 17 veresnya 2017 Procitovano 21 serpnya 2017 Div takozh red Hromosoma 20 nbsp Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Otrimano z https uk wikipedia org w index php title EIF6 amp oldid 35413391