EDN3 angl Endothelin 3 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 20 yi hromosomi 4 Dovzhina polipeptidnogo lancyuga bilka stanovit 238 aminokislot a molekulyarna masa 25 454 5 EDN3IdentifikatoriSimvoliEDN3 ET 3 ET3 HSCR4 PPET3 WS4B endothelin 3Zovnishni ID OMIM 131242 MGI 95285 HomoloGene 88 GeneCards EDN3Pov yazani genetichni zahvoryuvannyaWaardenburg syndrome type 4B 1 Ontologiya genaMolekulyarna funkciya hormone activity endothelin B receptor binding signaling receptor bindingKlitinna komponenta extracellular region vnutrishnoklitinnij extracellular spaceBiologichnij proces positive regulation of MAP kinase activity regulation of systemic arterial blood pressure by endothelin vasoconstriction cell cell signaling krovoobig neutrophil chemotaxis positive regulation of heart rate multicellular organism development positive regulation of leukocyte chemotaxis cell surface receptor signaling pathway vein smooth muscle contraction regulation of vasoconstriction peptide hormone secretion positive regulation of cell differentiation artery smooth muscle contraction Regulyaciya ekspresiyi geniv inositol phosphate mediated signaling positive regulation of mitotic nuclear division positive regulation of hormone secretion GO 0072468 Signalna transdukciya regulation of signaling receptor activity G protein coupled receptor signaling pathway neural crest cell migration cellular calcium ion homeostasis positive regulation of cell population proliferation cellular magnesium ion homeostasis neuron differentiation melanocyte differentiation regulation of cell migration regulation of developmental pigmentation positive regulation of potassium ion transmembrane transportDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez1908 13616Ensembl ENSG00000124205 ENSMUSG00000027524UniProt P14138 P48299RefSeq mRNK NM 000114NM 207032NM 207033NM 207034NM 001302455NM 001302456NM 007903RefSeq bilok NP 001289384NP 001289385NP 996915NP 996916NP 996917NP 031929Lokus UCSC Hr 20 59 3 59 33 MbHr 2 174 6 174 63 MbPubMed search 2 3 VikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050MEPGLWLLFGLTVTSAAGFVPCSQSGDAGRRGVSQAPTAARSEGDCEETVAGPGEETVAGPGEGTVAPTALQGPSPGSPGQEQAAEGAPEHHRSRRCTCFTYKDKECVYYCHLDIIWINTPEQTVPYGLSNYRGSFRGKRSAGPLPGNLQLSHRPHLRCACVGRYDKACLHFCTQTLDVSSNSRTAEKTDKEEEGKVEVKDQQSKQALDLHHPKLMPGSGLALAPSTCPRCLFQEGAPA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do vazoaktivnih bilkiv vazokonstriktoriv Zadiyanij u takomu biologichnomu procesi yak alternativnij splajsing Sekretovanij nazovni Literatura red The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PubMed DOI 10 1101 gr 2596504 Mills R G O Donoghue S I Smith R King G F 1992 Solution structure of endothelin 3 determined using NMR spectroscopy Biochemistry 31 5640 5645 PubMed DOI 10 1021 bi00139a030 Bloch K D Eddy R L Shows T B Quertermous T 1989 cDNA cloning and chromosomal assignment of the gene encoding endothelin 3 J Biol Chem 264 18156 18161 PubMed Hofstra R M W Osinga J Buys C H C M 1997 Mutations in Hirschsprung disease when does a mutation contribute to the phenotype Eur J Hum Genet 5 180 185 PubMedPrimitki red Zahvoryuvannya genetichno pov yazani z EDN3 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 3178 angl Arhiv originalu za 3 kvitnya 2016 Procitovano 12 veresnya 2017 UniProt P14138 angl Arhiv originalu za 8 serpnya 2017 Procitovano 12 veresnya 2017 Div takozh red Hromosoma 20 nbsp Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Otrimano z https uk wikipedia org w index php title EDN3 amp oldid 35413039