BDNF angl Brain derived neurotrophic factor bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 11 yi hromosomi 4 Dovzhina polipeptidnogo lancyuga bilka stanovit 247 aminokislot a molekulyarna masa 27 818 5 BDNFNayavni strukturiPDBPoshuk ortologiv PDBe RCSBSpisok kodiv PDB1BND 1B8MIdentifikatoriSimvoliBDNF brain derived neurotrophic factor ANON2 BULN2 Brain derived neurotrophic factor brain derived neurotrophic factorZovnishni ID OMIM 113505 MGI 88145 HomoloGene 7245 GeneCards BDNFPov yazani genetichni zahvoryuvannyaozhirinnya 1 Ontologiya genaMolekulyarna funkciya signaling receptor binding neurotrophin TRKB receptor binding growth factor activity GO 0001948 GO 0016582 protein bindingKlitinna komponenta citoplazma perinuclear region of cytoplasm mitohondriya nuclear speck GO 0016023 cytoplasmic vesicle extracellular region extracellular space Sinaptichni bulbashki Akson Dendrit nejrobiologiya Biologichnij proces brain derived neurotrophic factor receptor signaling pathway GO 1904089 negative regulation of neuron apoptotic process synapse assembly cell cell signaling positive regulation of brain derived neurotrophic factor receptor signaling pathway collateral sprouting positive regulation of synapse assembly positive regulation of collateral sprouting nejrobiologiya rozvitku axon guidance negative regulation of myotube differentiation positive regulation of receptor binding regulation of protein localization to cell surface regulation of signaling receptor activity activation of phospholipase C activity neurotrophin TRK receptor signaling pathway positive regulation of non membrane spanning protein tyrosine kinase activity transmembrane receptor protein tyrosine kinase signaling pathway peripheral nervous system development pam yat nerve development nerve growth factor signaling pathway regulation of neuron differentiation neuron projection morphogenesis modulation of chemical synaptic transmission positive regulation of neuron projection development negative regulation of apoptotic signaling pathwayDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez627 12064Ensembl ENSG00000176697 ENSMUSG00000048482UniProt P23560 P21237RefSeq mRNK NM 001143805NM 001143806NM 001143807NM 001143808NM 001143809NM 001143810NM 001143811NM 001143812NM 001143813NM 001143814NM 001143815NM 001143816NM 001709NM 170731NM 170732NM 170733NM 170734NM 170735NM 001048139NM 001048141NM 001048142NM 007540NM 001285416NM 001285417NM 001285418NM 001285419NM 001285420NM 001285421NM 001285422NM 001316310RefSeq bilok NP 001137277NP 001137278NP 001137279NP 001137280NP 001137281NP 001137282NP 001137283NP 001137284NP 001137285NP 001137286NP 001137288NP 001700NP 733927NP 733928NP 733929NP 733930NP 733931NP 001041604NP 001041606NP 001041607NP 001272345NP 001272346NP 001272347NP 001272348NP 001272349NP 001272350NP 001272351NP 001303239NP 031566Lokus UCSC Hr 11 27 65 27 72 MbHr 2 109 51 109 56 MbPubMed search 2 3 VikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050MTILFLTMVISYFGCMKAAPMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGRA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do faktoriv rostu Zadiyanij u takomu biologichnomu procesi yak alternativnij splajsing Sekretovanij nazovni Literatura RedaguvatiJones K R Reichardt L F 1990 Molecular cloning of a human gene that is a member of the nerve growth factor family Proc Natl Acad Sci U S A 87 8060 8064 PubMed DOI 10 1073 pnas 87 20 8060 Shintani A Ono Y Kaisho Y Igarashi K 1992 Characterization of the 5 flanking region of the human brain derived neurotrophic factor gene Biochem Biophys Res Commun 182 325 332 PubMed DOI 10 1016 S0006 291X 05 80148 2 Pruunsild P Kazantseva A Aid T Palm K Timmusk T 2007 Dissecting the human BDNF locus bidirectional transcription complex splicing and multiple promoters Genomics 90 397 406 PubMed DOI 10 1016 j ygeno 2007 05 004 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PubMed DOI 10 1101 gr 2596504 Hallboeoek F Ibanez C F Persson H 1991 Evolutionary studies of the nerve growth factor family reveal a novel member abundantly expressed in Xenopus ovary Neuron 6 845 858 PubMed DOI 10 1016 0896 6273 91 90180 8 Robinson R C Radziejewski C Stuart D I Jones E Y 1995 Structure of the brain derived neurotrophic factor neurotrophin 3 heterodimer Biochemistry 34 4139 4146 PubMed DOI 10 1021 bi00013a001Primitki Redaguvati Zahvoryuvannya genetichno pov yazani z BDNF pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 1033 angl Arhiv originalu za 13 lipnya 2017 Procitovano 8 veresnya 2017 UniProt P23560 angl Arhiv originalu za 5 veresnya 2017 Procitovano 8 veresnya 2017 Div takozh RedaguvatiHromosoma 11 nbsp Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Otrimano z https uk wikipedia org w index php title BDNF amp oldid 37398371
