www.wikidata.uk-ua.nina.az
ABHD6 angl Abhydrolase domain containing 6 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 3 yi hromosomi 3 Dovzhina polipeptidnogo lancyuga bilka stanovit 337 aminokislot a molekulyarna masa 38 331 4 ABHD6IdentifikatoriSimvoliABHD6 abhydrolase domain containing 6 abhydrolase domain containing 6 acylglycerol lipaseZovnishni ID OMIM 616966 MGI 1913332 HomoloGene 23246 GeneCards ABHD6Ontologiya genaMolekulyarna funkciya katalitichna aktivnist hydrolase activity acylglycerol lipase activity phospholipase activityKlitinna komponenta integral component of membrane klitinna membrana AMPA glutamate receptor complex membrana mitohondriya glutamatergic synapse GABA ergic synapse integral component of postsynaptic membrane lysosomal membrane late endosome membrane lizosoma endosoma mitohondrialna membranaBiologichnij proces acylglycerol catabolic process negative regulation of cell migration positive regulation of lipid biosynthetic process regulation of endocannabinoid signaling pathway phospholipid catabolic process Dovgotrivale prignichennya negative regulation of cold induced thermogenesis monoacylglycerol catabolic process lysobisphosphatidic acid metabolic process lipid metabolismDzherela Amigo QuickGOOrtologiVidi Lyudina MishaEntrez57406 66082Ensembl ENSG00000163686 ENSMUSG00000025277UniProt Q9BV23 Q8R2Y0RefSeq mRNK NM 020676NM 001320126NM 025341NM 001331064NM 001331065RefSeq bilok NP 001307055NP 065727NP 065727 4NP 001307055 1NP 001317993NP 001317994NP 079617Lokus UCSC Hr 3 58 24 58 3 MbHr 14 14 41 14 47 MbPubMed search 1 2 VikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050MDLDVVNMFVIAGGTLAIPILAFVASFLLWPSALIRIYYWYWRRTLGMQVRYVHHEDYQFCYSFRGRPGHKPSILMLHGFSAHKDMWLSVVKFLPKNLHLVCVDMPGHEGTTRSSLDDLSIDGQVKRIHQFVECLKLNKKPFHLVGTSMGGQVAGVYAAYYPSDVSSLCLVCPAGLQYSTDNQFVQRLKELQGSAAVEKIPLIPSTPEEMSEMLQLCSYVRFKVPQQILQGLVDVRIPHNNFYRKLFLEIVSEKSRYSLHQNMDKIKVPTQIIWGKQDQVLDVSGADMLAKSIANCQVELLENCGHSVVMERPRKTAKLIIDFLASVHNTDNNKKLDA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do gidrolaz Lokalizovanij u membrani mitohondriyi Literatura red The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PubMed DOI 10 1101 gr 2596504 Navia Paldanius D Savinainen J R Laitinen J T 2012 Biochemical and pharmacological characterization of human alpha beta hydrolase domain containing 6 ABHD6 and 12 ABHD12 J Lipid Res 53 2413 2424 PubMed DOI 10 1194 jlr M030411Primitki red Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 21398 angl Arhiv originalu za 10 veresnya 2015 Procitovano 30 serpnya 2017 UniProt Q9BV23 angl Arhiv originalu za 8 serpnya 2017 Procitovano 30 serpnya 2017 Div takozh red Hromosoma 3 nbsp Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Otrimano z https uk wikipedia org w index php title ABHD6 amp oldid 35334094