CCK angl Cholecystokinin bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 3 yi hromosomi 3 Dovzhina polipeptidnogo lancyuga bilka stanovit 115 aminokislot a molekulyarna masa 12 669 4 CCKIdentifikatoriSimvoliCCK cholecystokininZovnishni ID OMIM 118440 MGI 88297 HomoloGene 583 GeneCards CCKOntologiya genaMolekulyarna funkciya hormone activity GO 0001948 GO 0016582 protein binding neuropeptide hormone activity peptide hormone receptor bindingKlitinna komponenta Perikarion extracellular region terminal bouton neuronal cell body Dendrit nejrobiologiya Aksonnij gorbik axon initial segment extracellular space AksonBiologichnij proces regulation of sensory perception of pain eating behavior behavioral fear response negative regulation of appetite protein kinase C activating G protein coupled receptor signaling pathway positive regulation of mitochondrial depolarization positive regulation of glutamate secretion positive regulation of cell population proliferation positive regulation of protein oligomerization positive regulation of peptidyl tyrosine phosphorylation positive regulation of apoptotic process activation of cysteine type endopeptidase activity involved in apoptotic process GO 0072468 Signalna transdukciya release of cytochrome c from mitochondria GO 0097285 Apoptoz neuron migration axonogenesis regulation of signaling receptor activity G protein coupled receptor signaling pathway pam yat visual learning negative regulation of eating behavior positive regulation of sensory perception of pain negative regulation of behavioral fear response positive regulation of behavioral fear response travlennyaDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez885 12424Ensembl ENSG00000187094 ENSMUSG00000032532UniProt P06307 P09240RefSeq mRNK NM 000729NM 001174138NM 031161NM 001284508RefSeq bilok NP 000720NP 001167609NP 001271437NP 112438Lokus UCSC Hr 3 42 26 42 27 MbHr 9 121 32 121 32 MbPubMed search 1 2 VikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050MNSGVCLCVLMAVLAAGALTQPVPPADPAGSGLQRAEEAPRRQLRVSQRTDGESRAHLGALLARYIQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPSA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do gormoniv Zadiyanij u takomu biologichnomu procesi yak polimorfizm Sekretovanij nazovni Holecistokinin stimulyuye rozslablennya sfinktera Oddi zbilshuye strum pechinkovoyi zhovchi pidvishuye pankreatichnu sekreciyu znizhuye tisk u biliarnij sistemi viklikaye skorochennya vorotarya shlunka sho galmuye peremishennya perevarenoyi yizhi v dvanadcyatipalu kishku Holecistokinin ye blokatorom sekreciyi solyanoyi kisloti pariyetalnimi klitinami shlunka Zmist 1 Literatura 2 Primitki 3 Div takozh 4 PosilannyaLiteratura RedaguvatiThe status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PubMed DOI 10 1101 gr 2596504 Vishnuvardhan D Beinfeld M C 2000 Role of tyrosine sulfation and serine phosphorylation in the processing of procholecystokinin to amidated cholecystokinin and its secretion in transfected AtT 20 cells Biochemistry 39 13825 13830 PubMed DOI 10 1021 bi0011072 Kato K Takahashi Y Matsubara K 1985 Molecular cloning of the human cholecystokinin gene Ann N Y Acad Sci 448 613 615 Primitki Redaguvati Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 1569 angl Procitovano 30 serpnya 2017 UniProt P06307 angl Procitovano 30 serpnya 2017 Div takozh RedaguvatiHromosoma 3Posilannya RedaguvatiHolecistokinin Universalnij slovnik enciklopediya 4 te vid K Teka 2006 nbsp Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Otrimano z https uk wikipedia org w index php title Holecistokinin amp oldid 37108596