www.wikidata.uk-ua.nina.az
Interlejkin 4 angl Interleukin 4 IL4 IL4 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 5 yi hromosomi 3 IL4Nayavni strukturiPDBPoshuk ortologiv PDBe RCSBSpisok kodiv PDB1BBN 1BCN 1CYL 1HIJ 1HIK 1HZI 1IAR 1ITI 1ITL 1ITM 1RCB 2B8U 2B8X 2B8Y 2B8Z 2B90 2B91 2CYK 2D48 2INT 3BPL 3BPN 3QB7 4YDY 5FHXIdentifikatoriSimvoliIL4 Interleukin 4 IL 4Zovnishni ID MGI 96556 HomoloGene 491 GeneCards IL4Ontologiya genaMolekulyarna funkciya interleukin 4 receptor binding GO 0001948 GO 0016582 protein binding growth factor activity GO 0005145 cytokine receptor binding cytokine activityKlitinna komponenta extracellular region extracellular spaceBiologichnij proces positive regulation of T cell differentiation dendritic cell differentiation negative regulation of endothelial cell apoptotic process negative regulation of complement dependent cytotoxicity regulation of phosphorylation negative regulation of apoptotic process myeloid dendritic cell differentiation type 2 immune response B cell activation positive regulation of interleukin 13 production GO 0046730 GO 0046737 GO 0046738 GO 0046736 Imunna vidpovid B cell differentiation T helper 2 cell cytokine production regulation of isotype switching GO 0045996 negative regulation of transcription DNA templated negative regulation of epithelial cell migration regulation of signaling receptor activity cholesterol metabolic process positive regulation of B cell proliferation positive regulation of T cell proliferation T cell activation positive regulation of MHC class II biosynthetic process negative regulation of osteoclast differentiation GO 0060469 GO 0009371 positive regulation of transcription DNA templated GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II positive regulation of isotype switching to IgE isotypes positive regulation of isotype switching to IgG isotypes regulation of immune response cytokine mediated signaling pathway GO 1901313 positive regulation of gene expression positive regulation of macroautophagy positive regulation of tyrosine phosphorylation of STAT protein activation of Janus kinase activity positive regulation of receptor mediated endocytosis positive regulation of cold induced thermogenesis negative regulation of neuroinflammatory response positive regulation of amyloid beta clearance neuroinflammatory response positive regulation of cellular respiration positive regulation of ATP biosynthetic processDzherela Amigo QuickGOOrtologiVidi Lyudina MishaEntrez3565 16189Ensembl ENSG00000113520 ENSMUSG00000000869UniProt P05112 P07750RefSeq mRNK NM 000589 4NM 021283RefSeq bilok NP 000580NP 758858NP 001341919NP 067258Lokus UCSC Hr 5 132 01 132 02 MbHr 11 53 49 53 51 MbPubMed search 1 2 VikidaniDiv Red dlya lyudejDiv Red dlya mishejKodovanij genom bilok za funkciyami nalezhit do citokiniv faktoriv rostu Zadiyanij u takih biologichnih procesah yak polimorfizm alternativnij splajsing Sekretovanij nazovni Zmist 1 Istoriya 2 Struktura 3 Funkciyi 3 1 Zapalennya i zagoyennya ran 4 Literatura 5 Primitki 6 Div takozhIstoriya red Cej citokin vidkritij Morinom Govardom spilno z Vilyamom E Polom 4 a takozh Ellen Vitettoyu ta yiyi doslidnickoyu grupoyu v 1982 roci Chotiri roki po tomu bula vidilena nukleotidna poslidovnist lyudskogo IL4 z pidtverdzhennyam jogo podibnosti do bilku mishej pid nazvoyu B klitinnij stimulyuyuchij faktor 1 BCSF 1 5 Struktura red Poslidovnist aminokislot1020304050MGLTSQLLPPLFFLLACAGNFVHGHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSSA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Dovzhina polipeptidnogo lancyuga bilka stanovit 153 aminokislot a molekulyarna masa 17 492 6 IL 4 maye kompaktnu globulyarnu ukladku podibno do inshih citokiniv stabilizovanu troma disulfidnimi zv yazkami 7 V odnij polovini strukturi dominuye puchok z 4 alfa spiralej z livostoronnim zakruchuvannyam 8 Spirali antiparalelni z 2 z yednannyami yaki utvoryuyut dvolancyugovij antiparalelnij beta list 8 Funkciyi red Interlejkin 4 vikonuye bagato biologichnih funkcij zokrema posilennya proliferaciyi B limfocitiv i T limfocitiv diferenciyuvannya V klitin v plazmatichni klitini Vin ye klyuchovim regulyatorom gumoralnogo i adaptivnogo imunitetu IL 4 provokuye peremikannya klasu V klitin v IgE i posilyuye produkciyu MHC II klasu IL 4 zmenshuye produkciyu Th1 klitin makrofagiv interferonu gamma dendritnih klitin interlekinu 12 Giperprodukciya IL 4 napryamu pov yazana z alergiyeyu 9 Zapalennya i zagoyennya ran red Gistiociti vidigrayut vazhlivu rol u hronichnomu zapalenni i zagoyenni ran Prisutnist IL 4 poza sudinami spriyaye alternativnij aktivaciyi makrofagiv u klitini M2 ta ingibuye klasichnu aktivaciyu makrofagiv u klitini M1 Zbilshenya kilkosti reparativnih makrofagiv M2 suprovodzhuyetsya sekreciyeyu IL 10 i TFRb sho prizvodit do prignichennya patologichnogo zapalennya Vivilnennya arginazi prolinu poliaminaz i TFRb aktivovanoyu klitinoyu M2 pov yazano z reparaciyeyu ran i fibrozom 10 Literatura red Klein S C Golverdingen J Bouwens A G M Tilanus M G J 1995 An alternatively spliced interleukin 4 form in lymphoid cells Immunogenetics 41 57 57 PubMed DOI 10 1007 BF00188440 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PubMed DOI 10 1101 gr 2596504 Eder A Krafft Czepa H Krammer P H 1988 The 5 region of the human interleukin 4 gene structure and potential regulatory elements Nucleic Acids Res 16 772 772 PubMed DOI 10 1093 nar 16 2 772 Carr C Aykent S Kimack N M Levine A D 1991 Disulfide assignments in recombinant mouse and human interleukin 4 Biochemistry 30 1515 1523 PubMed DOI 10 1021 bi00220a011 Wlodaver A Pavlovsky A Gustchina A 1992 Crystal structure of human recombinant interleukin 4 at 2 25 A resolution FEBS Lett 309 59 64 PubMed DOI 10 1016 0014 5793 92 80739 4 Hage T Sebald W Reinemer P 1999 Crystal structure of the interleukin 4 receptor alpha chain complex reveals a mosaic binding interface Cell 97 271 281 PubMed DOI 10 1016 S0092 8674 00 80736 9Primitki red Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 6014 angl Arhiv originalu za 26 bereznya 2016 Procitovano 31 serpnya 2017 Howard M Paul WE 1982 Interleukins for B lymphocytes Lymphokine Res 1 1 1 4 PMID 6985399 Yokota T etal 1986 Isolation and characterization of a human interleukin cDNA clone homologous to mouse B cell stimulatory factor 1 that expresses B cell and T cell stimulating activities Proc Natl Acad Sci U S A 83 16 5894 8 PMC 386403 PMID 3016727 doi 10 1073 pnas 83 16 5894 UniProt P05112 angl Arhiv originalu za 8 serpnya 2017 Procitovano 31 serpnya 2017 Carr C Aykent S Kimack NM Levine AD February 1991 Disulfide assignments in recombinant mouse and human interleukin 4 Biochemistry 30 6 1515 1523 PMID 1993171 doi 10 1021 bi00220a011 a b Walter MR Cook WJ Zhao BG Cameron RP Ealick SE Walter RL Reichert P Nagabhushan TL Trotta PP Bugg CE October 1992 Crystal structure of recombinant human interleukin 4 J Biol Chem 267 28 20371 6 PMID 1400355 doi 10 2210 pdb2int pdb Hershey GK Friedrich MF Esswein LA Thomas ML Chatila TA December 1997 The association of atopy with a gain of function mutation in the alpha subunit of the interleukin 4 receptor N Engl J Med 337 24 1720 5 PMID 9392697 doi 10 1056 NEJM199712113372403 Arhiv originalu za 3 lyutogo 2015 Procitovano 5 serpnya 2023 Jon Aster Vinay Kumar Abul K Abbas Nelson Fausto 2009 Robbins amp Cotran Pathologic Basis of Disease vid 8th Philadelphia Saunders s 54 ISBN 978 1 4160 3121 5 Div takozh red Hromosoma 5 nbsp Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Otrimano z https uk wikipedia org w index php title Interlejkin 4 amp oldid 40601575