www.wikidata.uk-ua.nina.az

Аполіпопротеїн D Аполіпротеїн D англ Apolipoprotein D білок який кодується геном APOD розташованим у людей на короткому

Аполіпопротеїн D

Аполіпротеїн D (англ. Apolipoprotein D) – білок, який кодується геном APOD, розташованим у людей на короткому плечі 3-ї хромосоми. Довжина поліпептидного ланцюга білка становить 189 амінокислот, а молекулярна маса — 21 276.

Аполіпротеїн D
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи APOD, Apod, apolipoprotein D
Зовнішні ІД OMIM: 107740 MGI: 88056 HomoloGene: 1246 GeneCards: APOD
Шаблон експресії
Більше даних
Ортологи
Види Людина Миша
Entrez
347
11815
Ensembl
UniProt
RefSeq (мРНК)
RefSeq (білок)
Локус (UCSC) Хр. 3: 195.57 – 195.58 Mb Хр. 16: 31.12 – 31.13 Mb
PubMed search
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MVMLLLLLSALAGLFGAAEGQAFHLGKCPNPPVQENFDVNKYLGRWYEIE
KIPTTFENGRCIQANYSLMENGKIKVLNQELRADGTVNQIEGEATPVNLT
EPAKLEVKFSWFMPSAPYWILATDYENYALVYSCTCIIQLFHVDFAWILA
RNPNLPPETVDSLKNILTSNNIDVKKMTVTDQVNCPKLS

Задіяний у такому біологічному процесі як транспорт. Білок має сайт для зв'язування з ліпідами. Секретований назовні.

Література ред.

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PMID 15489334 DOI:10.1101/gr.2596504
  • Holzfeind P., Merschak P., Dieplinger H., Redl B. (1995). The human lacrimal gland synthesizes apolipoprotein D mRNA in addition to tear prealbumin mRNA, both species encoding members of the lipocalin superfamily.. Exp. Eye Res. 61: 495 — 500.  PMID 8549691 DOI:10.1016/S0014-4835(05)80145-9
  • Balbin M., Freije J.M.P., Fueyo A., Sanchez L.M., Lopez-Otin C. (1990). Apolipoprotein D is the major protein component in cyst fluid from women with human breast gross cystic disease.. Biochem. J. 271: 803 — 807.  PMID 2244881 DOI:10.1042/bj2710803
  • Bunkenborg J., Pilch B.J., Podtelejnikov A.V., Wisniewski J.R. (2004). Screening for N-glycosylated proteins by liquid chromatography mass spectrometry.. Proteomics. 4: 454 — 465.  PMID 14760718 DOI:10.1002/pmic.200300556
  • Halim A., Nilsson J., Ruetschi U., Hesse C., Larson G. (2011). Human urinary glycoproteomics; attachment site specific analysis of N-and O-linked glycosylations by CID and ECD.. Mol. Cell. Proteomics: —.  PMID 22171320 DOI:10.1074/mcp.M111.013649
  • Schindler P.A., Settineri C.A., Collet X., Fielding C.J., Burlingame A.L. (1995). Site-specific detection and structural characterization of the glycosylation of human plasma proteins lecithin:cholesterol acyltransferase and apolipoprotein D using HPLC/electrospray mass spectrometry and sequential glycosidase digestion.. Protein Sci. 4: 791 — 803.  PMID 7613477 DOI:10.1002/pro.5560040419

Примітки ред.

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:612 (англ.). Процитовано 30 січня 2017. 
  4. (англ.). Архів оригіналу за 5 лютого 2017. Процитовано 30 січня 2017. 

Див. також ред.

Це незавершена стаття про білки.
Ви можете допомогти проєкту, виправивши або дописавши її.
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри
Дата публікації:
Apoliproteyin D angl Apolipoprotein D bilok yakij koduyetsya genom APOD roztashovanim u lyudej na korotkomu plechi 3 yi hromosomi 3 Dovzhina polipeptidnogo lancyuga bilka stanovit 189 aminokislot a molekulyarna masa 21 276 4 Apoliproteyin DNayavni strukturiPDBPoshuk ortologiv PDBe RCSBSpisok kodiv PDB2HZQ 2HZRIdentifikatoriSimvoliAPOD Apod apolipoprotein DZovnishni ID OMIM 107740 MGI 88056 HomoloGene 1246 GeneCards APODOntologiya genaMolekulyarna funkciya lipid transporter activity transporter activity cholesterol binding GO 0001948 GO 0016582 protein binding small molecule binding lipid bindingKlitinna komponenta cytosolic ribosome vnutrishnoklitinnij neuronal cell body dendrit nejrobiologiya endoplazmatichnij retikulum perinuclear region of cytoplasm ekzosoma mizhklitinnij prostir extracellular region citoplazmaBiologichnij proces negative regulation of T cell migration negative regulation of platelet derived growth factor receptor signaling pathway negative regulation of monocyte chemotactic protein 1 production negative regulation of smooth muscle cell proliferation tissue regeneration lipid metabolism GO 0001315 response to reactive oxygen species negative regulation of smooth muscle cell matrix adhesion GO 0010260 starinnya lyudini negative regulation of lipoprotein lipid oxidation brain development peripheral nervous system axon regeneration response to axon injury Angiogenez glucose metabolic process negative regulation of focal adhesion assembly negative regulation of protein import into nucleus negative regulation of cytokine production involved in inflammatory response lipid transport GO 0015915 transportDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez347 11815Ensembl ENSG00000189058 ENSMUSG00000022548UniProt P05090 P51910RefSeq mRNK NM 001647NM 001301353NM 001301354NM 007470RefSeq bilok NP 001638NP 001288282NP 001288283NP 031496Lokus UCSC Hr 3 195 57 195 58 MbHr 16 31 12 31 13 MbPubMed search 1 2 VikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050MVMLLLLLSALAGLFGAAEGQAFHLGKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGRCIQANYSLMENGKIKVLNQELRADGTVNQIEGEATPVNLTEPAKLEVKFSWFMPSAPYWILATDYENYALVYSCTCIIQLFHVDFAWILARNPNLPPETVDSLKNILTSNNIDVKKMTVTDQVNCPKLSA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Zadiyanij u takomu biologichnomu procesi yak transport Bilok maye sajt dlya zv yazuvannya z lipidami Sekretovanij nazovni Literatura red The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Holzfeind P Merschak P Dieplinger H Redl B 1995 The human lacrimal gland synthesizes apolipoprotein D mRNA in addition to tear prealbumin mRNA both species encoding members of the lipocalin superfamily Exp Eye Res 61 495 500 PMID 8549691 DOI 10 1016 S0014 4835 05 80145 9 Balbin M Freije J M P Fueyo A Sanchez L M Lopez Otin C 1990 Apolipoprotein D is the major protein component in cyst fluid from women with human breast gross cystic disease Biochem J 271 803 807 PMID 2244881 DOI 10 1042 bj2710803 Bunkenborg J Pilch B J Podtelejnikov A V Wisniewski J R 2004 Screening for N glycosylated proteins by liquid chromatography mass spectrometry Proteomics 4 454 465 PMID 14760718 DOI 10 1002 pmic 200300556 Halim A Nilsson J Ruetschi U Hesse C Larson G 2011 Human urinary glycoproteomics attachment site specific analysis of N and O linked glycosylations by CID and ECD Mol Cell Proteomics PMID 22171320 DOI 10 1074 mcp M111 013649 Schindler P A Settineri C A Collet X Fielding C J Burlingame A L 1995 Site specific detection and structural characterization of the glycosylation of human plasma proteins lecithin cholesterol acyltransferase and apolipoprotein D using HPLC electrospray mass spectrometry and sequential glycosidase digestion Protein Sci 4 791 803 PMID 7613477 DOI 10 1002 pro 5560040419Primitki red Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 612 angl Procitovano 30 sichnya 2017 UniProt P05090 angl Arhiv originalu za 5 lyutogo 2017 Procitovano 30 sichnya 2017 Div takozh red Hromosoma 3 nbsp Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Otrimano z https uk wikipedia org w index php title Apolipoproteyin D amp oldid 35898876