www.wikidata.uk-ua.nina.az
SPN angl Sialophorin bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 16 yi hromosomi 3 Dovzhina polipeptidnogo lancyuga bilka stanovit 400 aminokislot a molekulyarna masa 40 322 4 SPNIdentifikatoriSimvoliSPN CD43 GALGP GPL115 LSN sialophorin LEU 22Zovnishni ID OMIM 182160 MGI 98384 HomoloGene 36108 GeneCards SPNOntologiya genaMolekulyarna funkciya transmembrane signaling receptor activity Hsp70 protein binding heat shock protein bindingKlitinna komponenta integral component of membrane membrana klitinna membrana integral component of plasma membrane Bazalna membrana cell surface uropod ekzosoma external side of plasma membrane extracellular spaceBiologichnij proces negative regulation of cell adhesion positive regulation of protein phosphorylation negative regulation of type IV hypersensitivity response to protozoan T cell costimulation negative thymic T cell selection hemotaksis establishment or maintenance of cell polarity cellular defense response cell surface receptor signaling pathway negative regulation of T cell proliferation defense response to bacterium GO 0046730 GO 0046737 GO 0046738 GO 0046736 Imunna vidpovid positive regulation of T cell proliferation regulation of immune response apoptotic signaling pathway regulation of defense response to virus negative regulation of T cell activation leukocyte migration GO 0072468 Signalna transdukciyaDzherela Amigo QuickGOOrtologiVidi Lyudina MishaEntrez6693 20737Ensembl ENSG00000197471 ENSMUSG00000051457UniProt P16150 P15702RefSeq mRNK NM 001030288NM 003123NM 001037810NM 009259RefSeq bilok NP 001025459NP 003114NP 001032899NP 033285Lokus UCSC Hr 16 29 66 29 67 MbHr 7 126 73 126 74 MbPubMed search 1 2 VikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050MATLLLLLGVLVVSPDALGSTTAVQTPTSGEPLVSTSEPLSSKMYTTSITSDPKADSTGDQTSALPPSTSINEGSPLWTSIGASTGSPLPEPTTYQEVSIKMSSVPQETPHATSHPAVPITANSLGSHTVTGGTITTNSPETSSRTSGAPVTTAASSLETSRGTSGPPLTMATVSLETSKGTSGPPVTMATDSLETSTGTTGPPVTMTTGSLEPSSGASGPQVSSVKLSTMMSPTTSTNASTVPFRNPDENSRGMLPVAVLVALLAVIVLVALLLLWRRRQKRRTGALVLSRGGKRNGVVDAWAGPAQVPEEGAVTVTVGGSGGDKGSGFPDGEGSSRRPTLTTFFGRRKSRQGSLAMEELKSGSGPSLKGEEEPLVASEDGAVDAPAPDEPEGGDGAAPA Alanin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do fosfoproteyiniv Lokalizovanij u membrani Literatura red Shelley C S Remold O Donnell E Rosen F S Whitehead D A S 1990 Structure of the human sialophorin CD43 gene Identification of features atypical of genes encoding integral membrane proteins Biochem J 270 569 576 PubMed DOI 10 1042 bj2700569 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PubMed DOI 10 1101 gr 2596504 Carrascal M Ovelleiro D Casas V Gay M Abian J 2008 Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment J Proteome Res 7 5167 5176 PubMed DOI 10 1021 pr800500r Kudo S Fukuda M 1991 A short novel promoter sequence confers the expression of human leukosialin a major sialoglycoprotein on leukocytes J Biol Chem 266 8483 8489 PubMed Piller V Piller F Fukuda M 1989 Phosphorylation of the major leukocyte surface sialoglycoprotein leukosialin is increased by phorbol 12 myristate 13 acetate J Biol Chem 264 18824 18831 PubMedPrimitki red Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 11249 angl Procitovano 11 veresnya 2017 UniProt P16150 angl Arhiv originalu za 12 veresnya 2017 Procitovano 11 veresnya 2017 Div takozh red Hromosoma 16 nbsp Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Otrimano z https uk wikipedia org w index php title SPN amp oldid 35723943