NPPC angl Natriuretic peptide C bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 2 yi hromosomi 3 Dovzhina polipeptidnogo lancyuga bilka stanovit 126 aminokislot a molekulyarna masa 13 246 4 NPPCNayavni strukturiPDBPoshuk ortologiv PDBe RCSBSpisok kodiv PDB1JDPIdentifikatoriSimvoliNPPC CNP CNP2 Natriuretic peptide precursor C natriuretic peptide CZovnishni ID OMIM 600296 MGI 97369 HomoloGene 7867 GeneCards NPPCOntologiya genaMolekulyarna funkciya protein homodimerization activity hormone activity peptide hormone receptor binding signaling receptor binding hormone receptor bindingKlitinna komponenta secretory granule extracellular region extracellular space GO 0009327 protein containing complexBiologichnij proces animal organ development negative regulation of meiotic cell cycle regulation of cardiac conduction growth plate cartilage chondrocyte proliferation response to hypoxia Osifikaciya regulation of multicellular organism growth negative regulation of oocyte maturation growth plate cartilage chondrocyte differentiation post embryonic development receptor guanylyl cyclase signaling pathway regulation of smooth muscle cell proliferation cGMP biosynthetic process positive regulation of osteoblast differentiation negative regulation of DNA metabolic process response to ethanol negative regulation of cell population proliferation Zgortannya bilkiv regulation of signaling receptor activity reproductive process cGMP mediated signaling positive regulation of cGMP mediated signaling negative regulation of collagen biosynthetic process negative regulation of DNA biosynthetic processDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez4880 18159Ensembl ENSG00000163273 ENSMUSG00000026241UniProt P23582 Q61839RefSeq mRNK NM 024409NM 010933RefSeq bilok NP 077720NP 035063Lokus UCSC Hr 2 231 92 231 93 MbHr 1 86 59 86 6 MbPubMed search 1 2 VikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050MHLSQLLACALLLTLLSLRPSEAKPGAPPKVPRTPPAEELAEPQAAGGGQKKGDKAPGGGGANLKGDRSRLLRDLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGCA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do gormoniv vazoaktivnih bilkiv Zadiyanij u takih biologichnih procesah yak osteogenez polimorfizm Sekretovanij nazovni Literatura red The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PubMed DOI 10 1101 gr 2596504 He X L Chow D C Martick M M Garcia K C 2001 Allosteric activation of a spring loaded natriuretic peptide receptor dimer by hormone Science 293 1657 1662 PubMed DOI 10 1126 science 1062246Primitki red Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 7941 angl Procitovano 28 serpnya 2017 UniProt P23582 angl Arhiv originalu za 17 chervnya 2017 Procitovano 28 serpnya 2017 Div takozh red Hromosoma 2 nbsp Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Otrimano z https uk wikipedia org w index php title NPPC amp oldid 35680653
