LTA angl Lymphotoxin alpha bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 6 yi hromosomi 3 Dovzhina polipeptidnogo lancyuga bilka stanovit 205 aminokislot a molekulyarna masa 22 297 4 LTANayavni strukturiPDBPoshuk ortologiv PDBe RCSBSpisok kodiv PDB1TNR 4MXV 4MXWIdentifikatoriSimvoliLTA LT TNFB TNFSF1 Lymphotoxin alpha TNLG1EZovnishni ID OMIM 153440 MGI 104797 HomoloGene 497 GeneCards LTAOntologiya genaMolekulyarna funkciya cytokine activity tumor necrosis factor receptor binding signaling receptor binding GO 0001948 GO 0016582 protein bindingKlitinna komponenta membrana klitinna membrana extracellular region extracellular spaceBiologichnij proces positive regulation of chronic inflammatory response to antigenic stimulus response to hypoxia response to nutrient cell cell signaling positive regulation of humoral immune response mediated by circulating immunoglobulin positive regulation of interferon gamma production tumor necrosis factor mediated signaling pathway response to lipopolysaccharide humoral immune response GO 0046730 GO 0046737 GO 0046738 GO 0046736 Imunna vidpovid positive regulation of apoptotic process lymph node development positive regulation of glial cell proliferation negative regulation of fibroblast proliferation GO 0072468 Signalna transdukciya GO 0051637 defense response to Gram positive bacterium GO 0097285 Apoptoz regulation of signaling receptor activityDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez4049 16992Ensembl ENSG00000231408ENSG00000223919ENSG00000173503ENSG00000226275ENSG00000230279ENSG00000238130ENSG00000226979 ENSMUSG00000024402UniProt P01374 P09225RefSeq mRNK NM 000595NM 001159740NM 010735RefSeq bilok NP 000586NP 001153212NP 034865Lokus UCSC Hr 6 31 57 31 57 MbHr 17 35 42 35 42 MbPubMed search 1 2 VikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050MTPPERLFLPRVCGTTLHLLLLGLLLVLLPGAQGLPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFALA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do citokiniv Lokalizovanij u membrani Takozh sekretovanij nazovni Literatura red Matsuyama N Okawa N Tsukii Y Endo T Kaji A 1992 Nucleotide sequence of a cDNA encoding human tumor necrosis factor beta from B lymphoblastoid cell RPMI 1788 FEBS Lett 302 141 144 PubMed DOI 10 1016 0014 5793 92 80425 G The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PubMed DOI 10 1101 gr 2596504 Voigt C G Maurer Fogy I Adolf G R 1992 Natural human tumor necrosis factor beta lymphotoxin Variable O glycosylation at Thr7 proteolytic processing and allelic variation FEBS Lett 314 85 88 PubMed DOI 10 1016 0014 5793 92 81467 Z Abraham L J Du D C Zahedi K Dawkins R L Whitehead A S 1991 Haplotypic polymorphisms of the TNFB gene Immunogenetics 33 50 53 PubMed DOI 10 1007 BF00211695 Kobayashi Y Miyamoto D Asada M Obinata M Osawa T 1986 Cloning and expression of human lymphotoxin mRNA derived from a human T cell hybridoma J Biochem 100 727 733 PubMed Neville M J Campbell R D 1999 A new member of the Ig superfamily and a V ATPase G subunit are among the predicted products of novel genes close to the TNF locus in the human MHC J Immunol 162 4745 4754 PubMedPrimitki red Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 6709 angl Arhiv originalu za 13 chervnya 2015 Procitovano 6 veresnya 2017 UniProt P01374 angl Arhiv originalu za 19 veresnya 2017 Procitovano 6 veresnya 2017 Div takozh red Hromosoma 6 nbsp Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Otrimano z https uk wikipedia org w index php title Limfotoksin alfa amp oldid 36348402