www.wikidata.uk-ua.nina.az
LPAR6 angl Lysophosphatidic acid receptor 6 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 13 yi hromosomi 5 Dovzhina polipeptidnogo lancyuga bilka stanovit 344 aminokislot a molekulyarna masa 39 392 6 LPAR6IdentifikatoriSimvoliLPAR6 ARWH1 HYPT8 LAH3 P2RY5 P2Y5 lysophosphatidic acid receptor 6 LPA 6Zovnishni ID OMIM 609239 MGI 1914418 HomoloGene 55925 GeneCards LPAR6Pov yazani genetichni zahvoryuvannyahypotrichosis 8 1 Reaguye na spolukulysophosphatidic acid 2 Ontologiya genaMolekulyarna funkciya G protein coupled receptor activity signal transducer activity lysophosphatidic acid receptor activityKlitinna komponenta integral component of membrane klitinna membrana membrana integral component of plasma membrane vnutrishnoklitinna membranna organelaBiologichnij proces GO 0072468 Signalna transdukciya positive regulation of Rho protein signal transduction positive regulation of cytosolic calcium ion concentration involved in phospholipase C activating G protein coupled signaling pathway G protein coupled receptor signaling pathway blastocyst hatchingDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez10161 67168Ensembl ENSG00000139679 ENSMUSG00000033446UniProt P43657 Q8BMC0RefSeq mRNK NM 005767NM 001162497NM 001162498NM 001377316NM 001377317NM 175116RefSeq bilok NP 001155969NP 001155970NP 005758NP 001364245NP 001364246NP 780325Lokus UCSC Hr 13 48 39 48 44 MbHr 14 73 48 73 48 MbPubMed search 3 4 VikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050MVSVNSSHCFYNDSFKYTLYGCMFSMVFVLGLISNCVAIYIFICVLKVRNETTTYMINLAMSDLLFVFTLPFRIFYFTTRNWPFGDLLCKISVMLFYTNMYGSILFLTCISVDRFLAIVYPFKSKTLRTKRNAKIVCTGVWLTVIGGSAPAVFVQSTHSQGNNASEACFENFPEATWKTYLSRIVIFIEIVGFFIPLILNVTCSSMVLKTLTKPVTLSRSKINKTKVLKMIFVHLIIFCFCFVPYNINLILYSLVRTQTFVNCSVVAAVRTMYPITLCIAVSNCCFDPIVYYFTSDTIQNSIKMKNWSVRRSDFRFSEVHGAENFIQHNLQTLKSKIFDNESAAA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do receptoriv g bilokspryazhenih receptoriv bilkiv vnutrishnoklitinnogo signalingu Lokalizovanij u klitinnij membrani membrani Literatura red Herzog H Darby K Hort Y J Shine J 1996 Intron 17 of the human retinoblastoma susceptibility gene encodes an actively transcribed G protein coupled receptor gene Genome Res 6 858 861 PubMed DOI 10 1101 gr 6 9 858 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PubMed DOI 10 1101 gr 2596504 Adrian K Bernhard M K Breitinger H G Ogilvie A 2000 Expression of purinergic receptors ionotropic P2X1 7 and metabotropic P2Y1 11 during myeloid differentiation of HL60 cells Biochim Biophys Acta 1492 127 138 PubMed DOI 10 1016 S0167 4781 00 00094 4Primitki red Zahvoryuvannya genetichno pov yazani z LPAR6 pereglyanuti redaguvati posilannya na VikiDanih Spoluki yaki fizichno vzayemodiyut z Lysophosphatidic acid receptor 6 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 15520 angl Procitovano 11 veresnya 2017 UniProt P43657 angl Arhiv originalu za 8 serpnya 2017 Procitovano 11 veresnya 2017 Div takozh red Hromosoma 13 nbsp Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Otrimano z https uk wikipedia org w index php title LPAR6 amp oldid 38132569