IL10 angl Interleukin 10 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 1 yi hromosomi 4 Dovzhina polipeptidnogo lancyuga bilka stanovit 178 aminokislot a molekulyarna masa 20 517 5 IL10Nayavni strukturiPDBPoshuk ortologiv PDBe RCSBSpisok kodiv PDB1ILK 1INR 1J7V 1LK3 1Y6K 2ILK 2H24IdentifikatoriSimvoliIL10 CSIF GVHDS IL 10 IL10A TGIF interleukin 10Zovnishni ID OMIM 124092 MGI 96537 HomoloGene 478 GeneCards IL10Pov yazani genetichni zahvoryuvannyasindrom Behcheta nespecifichnij virazkovij kolit 1 Ontologiya genaMolekulyarna funkciya GO 0001948 GO 0016582 protein binding growth factor activity cytokine activity interleukin 10 receptor binding protein dimerization activityKlitinna komponenta extracellular region extracellular spaceBiologichnij proces negative regulation of chronic inflammatory response to antigenic stimulus positive regulation of MHC class II biosynthetic process negative regulation of endothelial cell apoptotic process krovotvorennya negative regulation of interferon gamma production regulation of sensory perception of pain positive regulation of B cell apoptotic process negative regulation of chemokine C C motif ligand 5 production response to inactivity negative regulation of cytokine activity negative regulation of interleukin 1 production cellular response to hepatocyte growth factor stimulus cellular response to estradiol stimulus negative regulation of interleukin 6 production GO 0010260 starinnya lyudini positive regulation of DNA binding transcription factor activity negative regulation of apoptotic process GO 0002719 negative regulation of cytokine production involved in immune response response to glucocorticoid cytoplasmic sequestering of NF kappaB negative regulation of interleukin 18 production negative regulation of MHC class II biosynthetic process response to activity response to organic substance response to carbon monoxide leukocyte chemotaxis type 2 immune response negative regulation of myeloid dendritic cell activation response to insulin negative regulation of interleukin 8 production response to lipopolysaccharide B cell proliferation negative regulation of T cell proliferation negative regulation of nitric oxide biosynthetic process branching involved in labyrinthine layer morphogenesis defense response to bacterium regulation of complement dependent cytotoxicity GO 0046730 GO 0046737 GO 0046738 GO 0046736 Imunna vidpovid Regulyaciya ekspresiyi geniv B cell differentiation regulation of isotype switching negative regulation of tumor necrosis factor production negative regulation of membrane protein ectodomain proteolysis inflammatory response cellular response to lipopolysaccharide negative regulation of B cell proliferation negative regulation of inflammatory response GO 0032697 negative regulation of cytokine production GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II negative regulation of interleukin 12 production defense response to protozoan negative regulation of sensory perception of pain positive regulation of macrophage activation liver regeneration GO 1904739 regulation of synapse organization positive regulation of endothelial cell proliferation negative regulation of cell population proliferation negative regulation of heterotypic cell cell adhesion positive regulation of heterotypic cell cell adhesion positive regulation of cell cycle negative regulation of mitotic cell cycle endothelial cell apoptotic process regulation of response to wounding negative regulation of vascular associated smooth muscle cell proliferation positive regulation of vascular associated smooth muscle cell proliferation interleukin 12 mediated signaling pathway GO 0060469 GO 0009371 positive regulation of transcription DNA templated negative regulation of autophagy cytokine mediated signaling pathway positive regulation of receptor signaling pathway via JAK STAT positive regulation of pri miRNA transcription by RNA polymerase II negative regulation of hydrogen peroxide induced neuron death positive regulation of sprouting angiogenesisDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez3586 16153Ensembl ENSG00000136634 ENSMUSG00000016529UniProt P22301 P18893RefSeq mRNK NM 000572NM 010548RefSeq bilok NP 000563NP 034678Lokus UCSC Hr 1 206 77 206 77 MbHr 1 130 95 130 95 MbPubMed search 2 3 VikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050MHSSALLCCLVLLTGVRASPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRNA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do citokiniv Sekretovanij nazovni Literatura RedaguvatiZhang Z Henzel W J 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites Protein Sci 13 2819 2824 PubMed DOI 10 1110 ps 04682504 Walter M R Nagabhushan T L 1995 Crystal structure of interleukin 10 reveals an interferon gamma like fold Biochemistry 34 12118 12125 PubMed DOI 10 1021 bi00038a004 Zdanov A Schalk Hihi C Wlodawer A 1996 Crystal structure of human interleukin 10 at 1 6 A resolution and a model of a complex with its soluble receptor Protein Sci 5 1955 1962 PubMed DOI 10 1002 pro 5560051001 Josephson K Logsdon N J Walter M R 2001 Crystal structure of the IL 10 IL 10R1 complex reveals a shared receptor binding site Immunity 15 35 46 PubMed DOI 10 1016 S1074 7613 01 00169 8 Yoon S I Jones B C Logsdon N J Walter M R 2005 Same structure different function crystal structure of the Epstein Barr virus IL 10 bound to the soluble IL 10R1 chain Structure 13 551 564 PubMed DOI 10 1016 j str 2005 01 016 Dai W J Jiang H C Pan S H 2001 Cloning sequencing of human interleukin 10 cDNA and construction of its eukaryotic expression vector Haerbin Yi Ke Da Xue Xue Bao 35 4 6 Primitki Redaguvati Zahvoryuvannya genetichno pov yazani z IL10 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 5962 angl Procitovano 25 serpnya 2017 UniProt P22301 angl Arhiv originalu za 20 serpnya 2017 Procitovano 25 serpnya 2017 Div takozh RedaguvatiHromosoma 1 nbsp Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Otrimano z https uk wikipedia org w index php title IL10 amp oldid 35645605
