HLA DRB1 angl HLA class II histocompatibility antigen DRB1 15 beta chain bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 6 yi hromosomi 2 Dovzhina polipeptidnogo lancyuga bilka stanovit 266 aminokislot a molekulyarna masa 29 966 3 HLA DRB1Nayavni strukturiPDBPoshuk dlya lyudej PDBe RCSBSpisok kodiv PDB1A6A 1BX2 1YMM 2WBJ s1AQD 1DLH 1FYT 1HXY 1JWM 1JWS 1JWU 1KG0 1KLG 1KLU 1LO5 1PYW 1R5I 1SEB 1SJH 1T5W 1T5X 2FSE 2G9H 2IAM 2IAN 2ICW 2IPK 2OJE 2XN9 3L6F 3PDO 3PGC 3PGD 3QXA 3QXD 3S4S 3S5L 4AEN 4AH2 4C56 4E41 4FQX 4GBX 4I5B 4OV5 4X5W 4X5X s1D5M 1D5X 1D5Z 1D6E 1J8H 2SEB 3O6F 3T0E 4IS6 4MCY 4MCZ 4MD0 4MD4 4MD5 4MDI 4MDJ 4Y19 4Y1AIdentifikatoriSimvoliHLA DRB1 DRB1 DRw10 HLA DR1B HLA DRB SS1 major histocompatibility complex class II DR beta 1Zovnishni ID OMIM 142857 HomoloGene 136635 GeneCards HLA DRB1Ontologiya genaMolekulyarna funkciya peptide antigen binding MHC class II receptor activity GO 0001948 GO 0016582 protein binding MHC class II protein complex bindingKlitinna komponenta integral component of membrane endocytic vesicle membrane clathrin coated endocytic vesicle membrane endosoma kompleks Goldzhi trans Golgi network membrane endoplasmic reticulum membrane membrana late endosome membrane Golgi membrane klitinna membrana transport vesicle membrane MHC class II protein complex lysosomal membrane endoplazmatichnij retikulum ER to Golgi transport vesicle membrane lizosoma integral component of lumenal side of endoplasmic reticulum membrane endosome membrane external side of plasma membrane cell surface ekzosomaBiologichnij proces antigen processing and presentation antigen processing and presentation of exogenous peptide antigen via MHC class II immune system process interferon gamma mediated signaling pathway immunoglobulin production involved in immunoglobulin mediated immune response antigen processing and presentation of peptide or polysaccharide antigen via MHC class II humoral immune response mediated by circulating immunoglobulin GO 0046730 GO 0046737 GO 0046738 GO 0046736 Imunna vidpovid peptide antigen assembly with MHC class II protein complex T cell receptor signaling pathway adaptive immune response negative regulation of interferon gamma production inflammatory response to antigenic stimulus protein tetramerization regulation of interleukin 4 production negative regulation of T cell proliferation T helper 1 type immune response positive regulation of insulin secretion involved in cellular response to glucose stimulus T cell costimulationDzherela Amigo QuickGOOrtologiVidi Lyudina MishaEntrez3123 n dEnsembl ENSG00000236884ENSG00000206240ENSG00000229074ENSG00000196126ENSG00000206306ENSG00000228080 n dUniProt P01911 n dRefSeq mRNK NM 001243965NM 002124NM 001359193NM 001359194n dRefSeq bilok NP 001230894NP 002115NP 001346122NP 001346123NP 002115 2n dLokus UCSC Hr 6 32 58 32 59 Mbn dPubMed search 1 n dVikidaniDiv Red dlya lyudej Poslidovnist aminokislot1020304050MVCLKLPGGSCMTALTVTLMVLSSPLALSGDTRPRFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFLNGQEEKAGMVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLSA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Zadiyanij u takomu biologichnomu procesi yak imunitet Lokalizovanij u klitinnij membrani membrani endoplazmatichnomu retikulumi lizosomi aparati goldzhi endosomah Literatura red Lock C B So A K Welsh K I Parkes J D Trowsdale J 1988 MHC class II sequences of an HLA DR2 narcoleptic Immunogenetics 27 449 455 PubMed DOI 10 1007 BF00364432 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PubMed DOI 10 1101 gr 2596504 Lee B S M Rust N A McMichael A J McDevitt H O 1987 HLA DR2 subtypes form an additional supertypic family of DR beta alleles Proc Natl Acad Sci U S A 84 4591 4595 PubMed DOI 10 1073 pnas 84 13 4591 Cresswell P 1996 Invariant chain structure and MHC class II function Cell 84 505 507 PubMed DOI 10 1016 S0092 8674 00 81025 9 Villadangos J A 2001 Presentation of antigens by MHC class II molecules getting the most out of them Mol Immunol 38 329 346 PubMed DOI 10 1016 S0161 5890 01 00069 4 Menendez Benito V Neefjes J 2007 Autophagy in MHC class II presentation sampling from within Immunity 26 1 3 PubMed DOI 10 1016 j immuni 2007 01 005Primitki red Human PubMed Reference HUGO Gene Nomenclature Commitee HGNC 4948 angl Arhiv originalu za 17 zhovtnya 2015 Procitovano 6 veresnya 2017 UniProt P01911 angl Arhiv originalu za 24 zhovtnya 2016 Procitovano 6 veresnya 2017 Div takozh red Hromosoma 6 nbsp Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Otrimano z https uk wikipedia org w index php title HLA DRB1 amp oldid 35628875
