FUT1 angl Fucosyltransferase 1 H blood group bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 19 yi hromosomi 3 Dovzhina polipeptidnogo lancyuga bilka stanovit 365 aminokislot a molekulyarna masa 41 251 4 FUT1IdentifikatoriSimvoliFUT1 HH HSC fucosyltransferase 1 H blood group HZovnishni ID OMIM 211100 MGI 109375 HomoloGene 120 GeneCards FUT1Ontologiya genaMolekulyarna funkciya transferase activity galactoside 2 alpha L fucosyltransferase activity fucosyltransferase activity glycosyltransferase activityKlitinna komponenta integral component of membrane Golgi cisterna membrane kompleks Goldzhi integral component of plasma membrane membranaBiologichnij proces GO 0033578 GO 0033577 GO 0033575 GO 0033576 protein glycosylation L fucose catabolic process fucosylation carbohydrate metabolic processDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez2523 14343Ensembl ENSG00000174951 ENSMUSG00000008461UniProt P19526 O09160RefSeq mRNK NM 000148NM 001329877NM 001384359NM 001271981NM 008051RefSeq bilok NP 000139NP 001316806NP 001258910NP 032077Lokus UCSC Hr 19 48 75 48 76 MbHr 7 45 27 45 27 MbPubMed search 1 2 VikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050MWLRSHRQLCLAFLLVCVLSVIFFLHIHQDSFPHGLGLSILCPDRRLVTPPVAIFCLPGTAMGPNASSSCPQHPASLSGTWTVYPNGRFGNQMGQYATLLALAQLNGRRAFILPAMHAALAPVFRITLPVLAPEVDSRTPWRELQLHDWMSEEYADLRDPFLKLSGFPCSWTFFHHLREQIRREFTLHDHLREEAQSVLGQLRLGRTGDRPRTFVGVHVRRGDYLQVMPQRWKGVVGDSAYLRQAMDWFRARHEAPVFVVTSNGMEWCKENIDTSQGDVTFAGDGQEATPWKDFALLTQCNHTIMTIGTFGFWAAYLAGGDTVYLANFTLPDSEFLKIFKPEAAFLPEWVGINADLSPLWTLAKPA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do transferaz glikoziltransferaz Lokalizovanij u membrani aparati goldzhi Literatura red Larsen R D Ernst L K Nair R P Lowe J B 1990 Molecular cloning sequence and expression of a human GDP L fucose beta D galactoside 2 alpha L fucosyltransferase cDNA that can form the H blood group antigen Proc Natl Acad Sci U S A 87 6674 6678 PubMed DOI 10 1073 pnas 87 17 6674 Wagner F F Flegel W A 1997 Polymorphism of the h allele and the population frequency of sporadic nonfunctional alleles Transfusion 37 284 290 PubMed DOI 10 1046 j 1537 2995 1997 37397240210 x The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PubMed DOI 10 1101 gr 2596504 Koda Y Soejima M Johnson P H Smart E Kimura H 1997 Missense mutation of FUT1 and deletion of FUT2 are responsible for Indian Bombay phenotype of ABO blood group system Biochem Biophys Res Commun 238 21 25 PubMed DOI 10 1006 bbrc 1997 7232Primitki red Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 4012 angl Arhiv originalu za 25 bereznya 2016 Procitovano 12 veresnya 2017 UniProt P19526 angl Arhiv originalu za 13 bereznya 2018 Procitovano 12 veresnya 2017 Div takozh red Hromosoma 19 nbsp Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Otrimano z https uk wikipedia org w index php title FUT1 amp oldid 35440704