FGF9 angl Fibroblast growth factor 9 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 13 yi hromosomi 3 Dovzhina polipeptidnogo lancyuga bilka stanovit 208 aminokislot a molekulyarna masa 23 441 4 FGF9Nayavni strukturiPDBPoshuk ortologiv PDBe RCSBSpisok kodiv PDB1G82 1IHKIdentifikatoriSimvoliFGF9 FGF 9 GAF HBFG 9 HBGF 9 SYNS3 fibroblast growth factor 9Zovnishni ID OMIM 600921 MGI 104723 HomoloGene 1523 GeneCards FGF9Ontologiya genaMolekulyarna funkciya heparin binding fibroblast growth factor receptor binding protein tyrosine kinase activity phosphatidylinositol 4 5 bisphosphate 3 kinase activity 1 phosphatidylinositol 3 kinase activity growth factor activityKlitinna komponenta citoplazma extracellular region Bazalna membrana ekzosoma extracellular spaceBiologichnij proces rozvitok oka positive regulation of vascular endothelial growth factor receptor signaling pathway Diferenciaciya klitin male gonad development chondrocyte differentiation substantia nigra development protein import into nucleus positive regulation of smoothened signaling pathway regulation of timing of cell differentiation positive regulation of epithelial cell proliferation lung development positive regulation of canonical Wnt signaling pathway negative regulation of Wnt signaling pathway GO 1901227 negative regulation of transcription by RNA polymerase II male sex determination MAPK cascade embryonic skeletal system development multicellular organism development GO 1901313 positive regulation of gene expression positive regulation of activin receptor signaling pathway positive regulation of cardiac muscle cell proliferation positive regulation of mesenchymal cell proliferation embryonic limb morphogenesis inner ear morphogenesis Angiogenez osteoblast differentiation positive regulation of cell population proliferation lung associated mesenchyme development embryonic digestive tract development positive regulation of cell division GO 0072468 Signalna transdukciya positive regulation of MAPK cascade phosphatidylinositol phosphate biosynthetic process fibroblast growth factor receptor signaling pathway cell cell signaling phosphatidylinositol 3 phosphate biosynthetic process peptidyl tyrosine phosphorylation regulation of signaling receptor activity positive regulation of protein kinase B signaling regulation of molecular function positive regulation of vascular associated smooth muscle cell proliferation positive regulation of vascular associated smooth muscle cell migration negative regulation of vascular associated smooth muscle cell differentiation involved in phenotypic switchingDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez2254 14180Ensembl ENSG00000102678 ENSMUSG00000021974UniProt P31371 P54130RefSeq mRNK NM 002010NM 013518RefSeq bilok NP 002001NP 038546Lokus UCSC Hr 13 21 67 21 7 MbHr 14 58 31 58 35 MbPubMed search 1 2 VikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050MAPLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQSA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do faktoriv rostu mitogeniv bilkiv rozvitku Zadiyanij u takomu biologichnomu procesi yak diferenciaciya klitin Bilok maye sajt dlya zv yazuvannya z z molekuloyu geparinu Sekretovanij nazovni Literatura RedaguvatiThe status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PubMed DOI 10 1101 gr 2596504 Turner N Grose R 2010 Fibroblast growth factor signalling from development to cancer Nat Rev Cancer 10 116 129 PubMed DOI 10 1038 nrc2780Primitki Redaguvati Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 3687 angl Procitovano 11 veresnya 2017 UniProt P31371 angl Arhiv originalu za 10 kvitnya 2018 Procitovano 11 veresnya 2017 Div takozh RedaguvatiHromosoma 13 nbsp Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Na cyu stattyu ne posilayutsya inshi statti Vikipediyi Bud laska skoristajtesya pidkazkoyu ta rozstavte posilannya vidpovidno do prijnyatih rekomendacij Otrimano z https uk wikipedia org w index php title FGF9 amp oldid 35438004