CLEC3B angl C type lectin domain family 3 member B bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 3 yi hromosomi 3 Dovzhina polipeptidnogo lancyuga bilka stanovit 202 aminokislot a molekulyarna masa 22 537 4 CLEC3BNayavni strukturiPDBPoshuk ortologiv PDBe RCSBSpisok kodiv PDB1HTN 1RJH 1TN3 3L9JIdentifikatoriSimvoliCLEC3B TN TNA C type lectin domain family 3 member BZovnishni ID OMIM 187520 MGI 104540 HomoloGene 31145 GeneCards CLEC3BOntologiya genaMolekulyarna funkciya calcium ion binding heparin binding kringle domain binding carbohydrate bindingKlitinna komponenta citoplazma GO 0005578 Pozaklitinna matricya ekzosoma granular component platelet dense granule lumen extracellular space extracellular region collagen containing extracellular matrixBiologichnij proces cellular response to organic substance bone mineralization cellular response to transforming growth factor beta stimulus positive regulation of plasminogen activation Osifikaciya platelet degranulationDzherela Amigo QuickGOOrtologiVidi Lyudina MishaEntrez7123 21922Ensembl ENSG00000163815 ENSMUSG00000025784UniProt P05452 P43025Q8CFZ6RefSeq mRNK NM 001308394NM 003278NM 011606RefSeq bilok NP 001295323NP 003269NP 035736Lokus UCSC Hr 3 45 45 04 MbHr 9 122 98 122 99 MbPubMed search 1 2 VikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050MELWGAYLLLCLFSLLTQVTTEPPTQKPKKIVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTVCLKGTKVHMKCFLAFTQTKTFHEASEDCISRGGTLGTPQTGSENDALYEYLRQSVGNEAEIWLGLNDMAAEGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQFGIVA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Bilok maye sajt dlya zv yazuvannya z lektinami Sekretovanij nazovni Literatura red Berglund L Petersen T E 1992 The gene structure of tetranectin a plasminogen binding protein FEBS Lett 309 15 19 PubMed DOI 10 1016 0014 5793 92 80729 Z The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PubMed DOI 10 1101 gr 2596504 Fuhlendorff J Clemmensen I Magnusson S 1987 Primary structure of tetranectin a plasminogen kringle 4 binding plasma protein homology with asialoglycoprotein receptors and cartilage proteoglycan core protein Biochemistry 26 6757 6764 PubMed DOI 10 1021 bi00395a027 Wewer U M Albrechtsen R 1992 Tetranectin a plasminogen kringle 4 binding protein Cloning and gene expression pattern in human colon cancer Lab Invest 67 253 262 PubMedPrimitki red Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 11891 angl Arhiv originalu za 17 chervnya 2017 Procitovano 6 lyutogo 2017 UniProt P05452 angl Arhiv originalu za 14 grudnya 2016 Procitovano 6 lyutogo 2017 Div takozh red Hromosoma 3 nbsp Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Otrimano z https uk wikipedia org w index php title CLEC3B amp oldid 35583223
