C1QB angl Complement C1q B chain bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 1 yi hromosomi 4 Dovzhina polipeptidnogo lancyuga bilka stanovit 253 aminokislot a molekulyarna masa 26 722 5 C1QBNayavni strukturiPDBPoshuk ortologiv PDBe RCSBSpisok kodiv PDB1PK6 2JG8 2JG9 2WNU 2WNV 5HZF 5HKJIdentifikatoriSimvoliC1QB complement C1q B chainZovnishni ID OMIM 120570 MGI 88224 HomoloGene 418 GeneCards C1QBPov yazani genetichni zahvoryuvannyaC1q deficiency 1 Ontologiya genaMolekulyarna funkciya GO 0001948 GO 0016582 protein binding protein homodimerization activity serine type endopeptidase activityKlitinna komponenta extracellular region Kolagen blood microparticle ekzosoma complement component C1 complex extracellular space collagen containing extracellular matrix sinaps postsynapseBiologichnij proces inner ear development complement activation complement activation classical pathway immune system process Vrodzhenij imunitet proteoliz regulation of complement activation synapse pruningDzherela Amigo QuickGOOrtologiVidi Lyudina MishaEntrez713 12260Ensembl ENSG00000173369 ENSMUSG00000036905UniProt P02746 P14106RefSeq mRNK NM 000491NM 001371184NM 001378156NM 009777RefSeq bilok NP 000482NP 001358113NP 001365085NP 033907Lokus UCSC Hr 1 22 65 22 66 MbHr 4 136 61 136 61 MbPubMed search 2 3 VikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050MMMKIPWGSIPVLMLLLLLGLIDISQAQLSCTGPPAIPGIPGIPGTPGPDGQPGTPGIKGEKGLPGLAGDHGEFGEKGDPGIPGNPGKVGPKGPMGPKGGPGAPGAPGPKGESGDYKATQKIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCKVPGLYYFTYHASSRGNLCVNLMRGRERAQKVVTFCDYAYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPDMEAA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Zadiyanij u takih biologichnih procesah yak imunitet vrodzhenij imunitet shlyah aktivaciyi komplementu Sekretovanij nazovni Literatura red The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PubMed DOI 10 1101 gr 2596504 Reid K B M 1985 Molecular cloning and characterization of the complementary DNA and gene coding for the B chain of subcomponent C1q of the human complement system Biochem J 231 729 735 PubMed DOI 10 1042 bj2310729 Reid K B M Thompson E O P 1978 Amino acid sequence of the N terminal 108 amino acid residues of the B chain of subcomponent C1q of the first component of human complement Biochem J 173 863 868 PubMed DOI 10 1042 bj1730863 Reid K B M 1979 Complete amino acid sequences of the three collagen like regions present in subcomponent C1q of the first component of human complement Biochem J 179 367 371 PubMed DOI 10 1042 bj1790367 Reid K B M Gagnon J Frampton J 1982 Completion of the amino acid sequences of the A and B chains of subcomponent C1q of the first component of human complement Biochem J 203 559 569 PubMed DOI 10 1042 bj2030559 Reid K B M Bentley D R Wood K J 1984 Cloning and characterization of the complementary DNA for the B chain of normal human serum C1q Philos Trans R Soc Lond B Biol Sci 306 345 354 PubMed DOI 10 1098 rstb 1984 0095Primitki red Zahvoryuvannya genetichno pov yazani z C1QB pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 1242 angl Arhiv originalu za 26 travnya 2017 Procitovano 21 serpnya 2017 UniProt P02746 angl Arhiv originalu za 24 lipnya 2017 Procitovano 21 serpnya 2017 Div takozh red Hromosoma 1 nbsp Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Otrimano z https uk wikipedia org w index php title C1QB amp oldid 35581135
