Apolipoproteyin E angl Apolipoprotein E bilok yakij koduyetsya genom APOE roztashovanim u lyudej na korotkomu plechi 19 yi hromosomi 4 Dovzhina polipeptidnogo lancyuga bilka stanovit 317 aminokislot a molekulyarna masa 36 154 5 Apolipoproteyin ENayavni strukturiPDBPoshuk ortologiv PDBe RCSBSpisok kodiv PDB1B68 1BZ4 1EA8 1GS9 1H7I 1LE2 1LE4 1LPE 1NFN 1NFO 1OEF 1OEG 1OR2 1OR3 2KC3 2KNY 2L7BIdentifikatoriSimvoliAPOE AD2 APO E LDLCQ5 LPG apolipoprotein E ApoE4Zovnishni ID OMIM 107741 MGI 88057 HomoloGene 30951 GeneCards APOEPov yazani genetichni zahvoryuvannyahvoroba Alcgejmera mikrocefaliya Alzheimer disease 2 sea blue histiocyte syndrome lipoprotein glomerulopathy ishemichna hvoroba sercya familial dysbetalipoproteinemia 1 Ontologiya genaMolekulyarna funkciya heparin binding very low density lipoprotein particle receptor binding low density lipoprotein particle receptor binding lipoprotein particle binding phosphatidylcholine sterol O acyltransferase activator activity phospholipid binding GO 0017127 cholesterol transfer activity protein homodimerization activity amyloid beta binding GO 0001948 GO 0016582 protein binding tau protein binding metal chelating activity lipid transporter activity cholesterol binding antioxidant activity identical protein binding lipid bindingKlitinna komponenta citoplazma membrana chylomicron extracellular region klitinne yadro extracellular vesicle endocytic vesicle lumen very low density lipoprotein particle extracellular fluid endoplazmatichnij retikulum ekzosoma kompleks Goldzhi blood microparticle GO 0005578 Pozaklitinna matricya klitinna membrana neuronal cell body early endosome low density lipoprotein particle Dendrit nejrobiologiya high density lipoprotein particle intermediate density lipoprotein particleBiologichnij proces GO 1904089 negative regulation of neuron apoptotic process response to dietary excess negative regulation of lipid transport across blood brain barrier lipid transport positive regulation of lipid biosynthetic process regulation of axon extension positive regulation of postsynaptic membrane organization positive regulation of cholesterol esterification phospholipid efflux cholesterol catabolic process positive regulation of dendritic spine development Receptor oposeredkovanij endocitoz retinoid metabolic process positive regulation of amyloid beta formation lipid homeostasis lipoprotein biosynthetic process cholesterol homeostasis negative regulation of inflammatory response triglyceride metabolic process negative regulation of canonical Wnt signaling pathway negative regulation of dendritic spine maintenance negative regulation of blood vessel endothelial cell migration NMDA glutamate receptor clustering GO 0001315 response to reactive oxygen species negative regulation of blood coagulation GO 0001306 response to oxidative stress positive regulation of nitric oxide synthase activity negative regulation of phospholipid efflux positive regulation of cholesterol efflux negative regulation of MAP kinase activity artery morphogenesis very low density lipoprotein particle remodeling regulation of neuronal synaptic plasticity negative regulation of dendritic spine development negative regulation of cholesterol biosynthetic process positive regulation of dendritic spine maintenance positive regulation of phospholipid efflux negative regulation of presynaptic membrane organization negative regulation of neuron death high density lipoprotein particle clearance long chain fatty acid transport lipoprotein metabolic process regulation of tau protein kinase activity G protein coupled receptor signaling pathway chylomicron remnant clearance cellular calcium ion homeostasis cholesterol metabolic process very low density lipoprotein particle clearance virion assembly negative regulation of lipid biosynthetic process cGMP mediated signaling triglyceride catabolic process positive regulation of presynaptic membrane organization positive regulation of neurofibrillary tangle assembly AMPA glutamate receptor clustering positive regulation of low density lipoprotein particle receptor catabolic process positive regulation of lipid transport across blood brain barrier fatty acid homeostasis nitric oxide mediated signal transduction GO 0015915 transport cholesterol efflux Regulyaciya ekspresiyi geniv negative regulation of cholesterol efflux regulation of amyloid beta clearance neuron projection regeneration negative regulation of postsynaptic membrane organization steroid metabolic process regulation of Cdc42 protein signal transduction lipid metabolism negative regulation of amyloid beta formation positive regulation of membrane protein ectodomain proteolysis vasodilation intracellular transport synaptic transmission cholinergic positive regulation of neuron death high density lipoprotein particle assembly protein import high density lipoprotein particle remodeling negative regulation of endothelial cell proliferation maintenance of location in cell negative regulation of platelet activation low density lipoprotein particle remodeling positive regulation by host of viral process cytoskeleton organization regulation of neuron death reverse cholesterol transport lipoprotein catabolic process triglyceride homeostasis cellular oxidant detoxification lipid transport involved in lipid storageDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez348 11816Ensembl ENSG00000130203 ENSMUSG00000002985UniProt P02649 P08226RefSeq mRNK NM 001302691NM 000041NM 001302688NM 001302689NM 001302690NM 009696NM 001305819NM 001305843NM 001305844RefSeq bilok NP 000032NP 001289617NP 001289618NP 001289619NP 001289620NP 001292748NP 001292772NP 001292773NP 033826Lokus UCSC Hr 19 44 91 44 91 MbHr 7 19 43 19 43 MbPubMed search 2 3 VikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050MKVLWAALLVTFLAGCQAKVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKVQAAVGTSAAPVPSDNHA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Zadiyanij u takih biologichnih procesah yak metabolizm lipidiv transport metabolizm holesterolu transport lipidiv metabolizm steroyidiv metabolizm steroliv Bilok maye sajt dlya zv yazuvannya z z molekuloyu geparinu Sekretovanij nazovni Literatura RedaguvatiThe status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PubMed DOI 10 1101 gr 2596504 Mahley R W 1988 Apolipoprotein E cholesterol transport protein with expanding role in cell biology Science 240 622 630 PubMed DOI 10 1126 science 3283935 Halim A Ruetschi U Larson G Nilsson J 2013 LC MS MS characterization of O glycosylation sites and glycan structures of human cerebrospinal fluid glycoproteins J Proteome Res 12 573 584 PubMed DOI 10 1021 pr300963h Wilson C Wardell M R Weisgraber K H Mahley R W Agard D A 1991 Three dimensional structure of the LDL receptor binding domain of human apolipoprotein E Science 252 1817 1822 PubMed DOI 10 1126 science 2063194 de Knijff P van den Maagdenberg A M J M Frants R R Havekes L M 1994 Genetic heterogeneity of apolipoprotein E and its influence on plasma lipid and lipoprotein levels Hum Mutat 4 178 194 PubMed DOI 10 1002 humu 1380040303 Zannis V I McPherson J Goldberger G Karathanasis S K Breslow J L 1984 Synthesis intracellular processing and signal peptide of human apolipoprotein E J Biol Chem 259 5495 5499 PubMedPrimitki Redaguvati Zahvoryuvannya genetichno pov yazani z Apolipoproteyin E pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 613 angl Arhiv originalu za 24 lipnya 2017 Procitovano 30 sichnya 2017 UniProt P02649 angl Arhiv originalu za 28 sichnya 2017 Procitovano 30 sichnya 2017 Div takozh RedaguvatiHromosoma 19 nbsp Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Otrimano z https uk wikipedia org w index php title Apolipoproteyin E amp oldid 35898879