www.wikidata.uk-ua.nina.az

Альфа 2 HS глікопротеїн англ Alpha 2 HS glycoprotein білок який кодується геном AHSG розташованим у людей на короткому п

Альфа-2-HS-глікопротеїн

Альфа-2-HS-глікопротеїн (англ. Alpha 2-HS glycoprotein) – білок, який кодується геном AHSG, розташованим у людей на короткому плечі 3-ї хромосоми. Довжина поліпептидного ланцюга білка становить 367 амінокислот, а молекулярна маса — 39 325.

Альфа-2-HS-глікопротеїн
Ідентифікатори
Символи AHSG, A2HS, AHS, FETUA, HSGA, alpha-2-HS-glycoprotein, alpha 2-HS glycoprotein
Зовнішні ІД OMIM: 138680 MGI: 107189 HomoloGene: 1225 GeneCards: AHSG
Шаблон експресії


Більше даних
Ортологи
Види Людина Миша
Entrez
197
11625
Ensembl
UniProt
RefSeq (мРНК)
RefSeq (білок)
Локус (UCSC) н/д Хр. 16: 22.71 – 22.72 Mb
PubMed search
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MKSLVLLLCLAQLWGCHSAPHGPGLIYRQPNCDDPETEEAALVAIDYINQ
NLPWGYKHTLNQIDEVKVWPQQPSGELFEIEIDTLETTCHVLDPTPVARC
SVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAEDVRKVCQDCP
LLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVE
FTVSGTDCVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCTVF
QTQPVTSQPQPEGANEAVPTPVVDPDAPPSPPLGAPGLPPAGSPPDSHVL
LAAPPGHQLHRAHYDLRHTFMGVVSLGSPSGEVSHPRKTRTVVQPSVGAA
AGPVVPPCPGRIRHFKV

Задіяний у такому біологічному процесі як мінеральний обмін. Секретований назовні.

Література ред.

  • Lee C.-C., Bowman B.H., Yang F. (1987). Human alpha 2-HS-glycoprotein: the A and B chains with a connecting sequence are encoded by a single mRNA transcript.. Proc. Natl. Acad. Sci. U.S.A. 84: 4403 — 4407.  PubMed DOI:10.1073/pnas.84.13.4403
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Araki T., Yoshioka Y., Schmid K. (1989). The position of the disulfide bonds in human plasma alpha 2 HS-glycoprotein and the repeating double disulfide bonds in the domain structure.. Biochim. Biophys. Acta. 994: 195 — 199.  PubMed DOI:10.1016/0167-4838(89)90293-8
  • Haglund A.C., Ek B., Ek P. (2001). Phosphorylation of human plasma alpha2-Heremans-Schmid glycoprotein (human fetuin) in vivo.. Biochem. J. 357: 437 — 445.  PubMed DOI:10.1042/0264-6021:3570437
  • Zhang H., Li X.-J., Martin D.B., Aebersold R. (2003). Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry.. Nat. Biotechnol. 21: 660 — 666.  PubMed DOI:10.1038/nbt827
  • Bunkenborg J., Pilch B.J., Podtelejnikov A.V., Wisniewski J.R. (2004). Screening for N-glycosylated proteins by liquid chromatography mass spectrometry.. Proteomics. 4: 454 — 465.  PubMed DOI:10.1002/pmic.200300556

Примітки ред.

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:349 (англ.). Процитовано 30 січня 2017. 
  4. (англ.). Архів оригіналу за 15 березня 2017. Процитовано 30 січня 2017. 

Див. також ред.


Це незавершена стаття про білки.
Ви можете допомогти проєкту, виправивши або дописавши її.
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри
Дата публікації:
Alfa 2 HS glikoproteyin angl Alpha 2 HS glycoprotein bilok yakij koduyetsya genom AHSG roztashovanim u lyudej na korotkomu plechi 3 yi hromosomi 3 Dovzhina polipeptidnogo lancyuga bilka stanovit 367 aminokislot a molekulyarna masa 39 325 4 Alfa 2 HS glikoproteyinIdentifikatoriSimvoliAHSG A2HS AHS FETUA HSGA alpha 2 HS glycoprotein alpha 2 HS glycoproteinZovnishni ID OMIM 138680 MGI 107189 HomoloGene 1225 GeneCards AHSGOntologiya genaMolekulyarna funkciya endopeptidase inhibitor activity cysteine type endopeptidase inhibitor activity kinase inhibitor activityKlitinna komponenta blood microparticle ekzosoma platelet alpha granule lumen extracellular space kompleks Goldzhi secretory granule lumen endoplasmic reticulum lumen GO 0005578 Pozaklitinna matricya extracellular region collagen containing extracellular matrixBiologichnij proces regulation of bone mineralization negative regulation of biomineral tissue development skeletal system development GO 1903105 negative regulation of insulin receptor signaling pathway positive regulation of phagocytosis Pinocitoz negative regulation of bone mineralization acute phase response Osifikaciya regulation of inflammatory response negative regulation of phosphorylation platelet degranulation negative regulation of endopeptidase activity neutrophil degranulation posttranslyacijna modifikaciya negative regulation of kinase activityDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez197 11625Ensembl ENSG00000145192 ENSMUSG00000022868UniProt P02765 P29699RefSeq mRNK NM 001622NM 001276449NM 001276450NM 013465RefSeq bilok NP 001613NP 001341500NP 001341501NP 001341502NP 001263378NP 001263379NP 038493Lokus UCSC n dHr 16 22 71 22 72 MbPubMed search 1 2 VikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050MKSLVLLLCLAQLWGCHSAPHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWPQQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAEDVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCTVFQTQPVTSQPQPEGANEAVPTPVVDPDAPPSPPLGAPGLPPAGSPPDSHVLLAAPPGHQLHRAHYDLRHTFMGVVSLGSPSGEVSHPRKTRTVVQPSVGAAAGPVVPPCPGRIRHFKVA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Zadiyanij u takomu biologichnomu procesi yak mineralnij obmin Sekretovanij nazovni Literatura red Lee C C Bowman B H Yang F 1987 Human alpha 2 HS glycoprotein the A and B chains with a connecting sequence are encoded by a single mRNA transcript Proc Natl Acad Sci U S A 84 4403 4407 PubMed DOI 10 1073 pnas 84 13 4403 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PubMed DOI 10 1101 gr 2596504 Araki T Yoshioka Y Schmid K 1989 The position of the disulfide bonds in human plasma alpha 2 HS glycoprotein and the repeating double disulfide bonds in the domain structure Biochim Biophys Acta 994 195 199 PubMed DOI 10 1016 0167 4838 89 90293 8 Haglund A C Ek B Ek P 2001 Phosphorylation of human plasma alpha2 Heremans Schmid glycoprotein human fetuin in vivo Biochem J 357 437 445 PubMed DOI 10 1042 0264 6021 3570437 Zhang H Li X J Martin D B Aebersold R 2003 Identification and quantification of N linked glycoproteins using hydrazide chemistry stable isotope labeling and mass spectrometry Nat Biotechnol 21 660 666 PubMed DOI 10 1038 nbt827 Bunkenborg J Pilch B J Podtelejnikov A V Wisniewski J R 2004 Screening for N glycosylated proteins by liquid chromatography mass spectrometry Proteomics 4 454 465 PubMed DOI 10 1002 pmic 200300556Primitki red Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 349 angl Procitovano 30 sichnya 2017 UniProt P02765 angl Arhiv originalu za 15 bereznya 2017 Procitovano 30 sichnya 2017 Div takozh red Hromosoma 3 nbsp Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Otrimano z https uk wikipedia org w index php title Alfa 2 HS glikoproteyin amp oldid 38966035