www.wikidata.uk-ua.nina.az
NPY angl Neuropeptide Y bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 7 yi hromosomi 3 Dovzhina polipeptidnogo lancyuga bilka stanovit 97 aminokislot a molekulyarna masa 10 851 4 NPYNayavni strukturiPDBPoshuk ortologiv PDBe RCSBSpisok kodiv PDB1RON 1QFAIdentifikatoriSimvoliNPY PYY4 Neuropeptid Y gene neuropeptide YZovnishni ID OMIM 162640 MGI 97374 HomoloGene 697 GeneCards NPYOntologiya genaMolekulyarna funkciya G protein coupled receptor activity hormone activity calcium channel regulator activity neuropeptide hormone activity signaling receptor binding G protein coupled receptor binding neuropeptide Y receptor bindingKlitinna komponenta citoplazma kompleks Goldzhi extracellular region extracellular spaceBiologichnij proces positive regulation of appetite adult feeding behavior G protein coupled receptor signaling pathway coupled to cyclic nucleotide second messenger regulation of blood pressure central nervous system neuron development harchova povedinka cerebral cortex development regulation of appetite proliferaciya Vrodzhenij imunitet neuropeptide signaling pathway neuron projection development calcium ion transport chemical synaptic transmission antimicrobial humoral immune response mediated by antimicrobial peptide regulation of signaling receptor activity G protein coupled receptor signaling pathway intestinal epithelial cell differentiationDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez4852 109648Ensembl ENSG00000122585 ENSMUSG00000029819UniProt P01303 P57774RefSeq mRNK NM 000905NM 023456RefSeq bilok NP 000896NP 075945Lokus UCSC Hr 7 24 28 24 29 MbHr 6 49 8 49 81 MbPubMed search 1 2 VikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050MLGNKRLGLSGLTLALSLLVCLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSPETLISDLLMRESTENVPRTRLEDPAMWA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do fosfoproteyiniv Sekretovanij nazovni Literatura RedaguvatiMinth C D Bloom S R Polak J M Dixon J E 1984 Cloning characterization and DNA sequence of a human cDNA encoding neuropeptide tyrosine Proc Natl Acad Sci U S A 81 4577 4581 PubMed DOI 10 1073 pnas 81 14 4577 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PubMed DOI 10 1101 gr 2596504 Allen J M Polak J M Bloom S R 1985 Presence of the predicted C flanking peptide of neuropeptide Y CPON in tissue extracts Neuropeptides 6 95 100 PubMed DOI 10 1016 0143 4179 85 90100 3 Keane F M Nadvi N A Yao T W Gorrell M D 2011 Neuropeptide Y B type natriuretic peptide substance P and peptide YY are novel substrates of fibroblast activation protein alpha FEBS J 278 1316 1332 PubMed DOI 10 1111 j 1742 4658 2011 08051 x Monks S A Karagianis G Howlett G J Norton R S 1996 Solution structure of human neuropeptide Y J Biomol NMR 8 379 390 PubMed DOI 10 1007 BF00228141 Barnham K J Catalfamo F Pallaghy P K Howlett G J Norton R S 1999 Helical structure and self association in a 13 residue neuropeptide Y Y2 receptor agonist relationship to biological activity Biochim Biophys Acta 1435 127 137 PubMed DOI 10 1016 S0167 4838 99 00214 9Primitki Redaguvati Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 7955 angl Procitovano 7 veresnya 2017 UniProt P01303 angl Procitovano 7 veresnya 2017 Div takozh RedaguvatiHromosoma 7 nbsp Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Otrimano z https uk wikipedia org w index php title Nejropeptid Y amp oldid 38241988