www.wikidata.uk-ua.nina.az
Keratin 9 angl Keratin 9 bilok yakij koduyetsya genom KRT9 roztashovanim u lyudej na korotkomu plechi 17 yi hromosomi 2 Dovzhina polipeptidnogo lancyuga bilka stanovit 623 aminokislot a molekulyarna masa 62 064 3 Nalezhit do velikoyi rodini keratiniv strukturnih bilkiv citoskeletu Keratin 9IdentifikatoriSimvoliKRT9 CK 9 EPPK K9 keratin 9Zovnishni ID OMIM 607606 HomoloGene 133554 GeneCards KRT9Ontologiya genaMolekulyarna funkciya structural constituent of cytoskeleton structural molecule activityKlitinna komponenta ekzosoma Promizhni filamenti membrana klitinne yadro extracellular space gialoplazmaBiologichnij proces intermediate filament organization Spermatogenez skin development epidermis development keratinization cornificationDzherela Amigo QuickGOOrtologiVidi Lyudina MishaEntrez3857 n dEnsembl ENSG00000171403 n dUniProt P35527 n dRefSeq mRNK NM 000226n dRefSeq bilok NP 000217n dLokus UCSC Hr 17 41 57 41 57 Mbn dPubMed search 1 n dVikidaniDiv Red dlya lyudej Poslidovnist aminokislot1020304050MSCRQFSSSYLSRSGGGGGGGLGSGGSIRSSYSRFSSSGGGGGGGRFSSSSGYGGGSSRVCGRGGGGSFGYSYGGGSGGGFSASSLGGGFGGGSRGFGGASGGGYSSSGGFGGGFGGGSGGGFGGGYGSGFGGFGGFGGGAGGGDGGILTANEKSTMQELNSRLASYLDKVQALEEANNDLENKIQDWYDKKGPAAIQKNYSPYYNTIDDLKDQIVDLTVGNNKTLLDIDNTRMTLDDFRIKFEMEQNLRQGVDADINGLRQVLDNLTMEKSDLEMQYETLQEELMALKKNHKEEMSQLTGQNSGDVNVEINVAPGKDLTKTLNDMRQEYEQLIAKNRKDIENQYETQITQIEHEVSSSGQEVQSSAKEVTQLRHGVQELEIELQSQLSKKAALEKSLEDTKNRYCGQLQMIQEQISNLEAQITDVRQEIECQNQEYSLLLSIKMRLEKEIETYHNLLEGGQEDFESSGAGKIGLGGRGGSGGSYGRGSRGGSGGSYGGGGSGGGYGGGSGSRGGSGGSYGGGSGSGGGSGGGYGGGSGGGHSGGSGGGHSGGSGGNYGGGSGSGGGSGGGYGGGSGSRGGSGGSHGGGSGFGGESGGSYGGGEEASGSGGGYGGGSGKSSHSA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y TirozinLiteratura red Langbein L Heid H W Moll I Franke W W 1993 Molecular characterization of the body site specific human epidermal cytokeratin 9 cDNA cloning amino acid sequence and tissue specificity of gene expression Differentiation 55 57 72 PubMed DOI 10 1111 j 1432 0436 1993 tb00033 x Kobayashi S Tanaka T Matsuyoshi N Imamura S 1996 Keratin 9 point mutation in the pedigree of epidermolytic hereditary palmoplantar keratoderma perturbs keratin intermediate filament network formation FEBS Lett 386 149 155 PubMed DOI 10 1016 0014 5793 96 00393 6 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PubMed DOI 10 1101 gr 2596504 Rosen E M Meromsky L Romero R Setter E Goldberg I 1990 Human placenta contains an epithelial scatter protein Biochem Biophys Res Commun 168 1082 1088 PubMed DOI 10 1016 0006 291X 90 91140 N Kobayashi S Kore eda S Tanaka T 1999 Demonstration of the pathogenic effect of point mutated keratin 9 in vivo FEBS Lett 447 39 43 PubMed DOI 10 1016 S0014 5793 99 00233 1 Hennies H C Zehender D Kunze J Kuester W Reis A 1994 Keratin 9 gene mutational heterogeneity in patients with epidermolytic palmoplantar keratoderma Hum Genet 93 649 654 PubMed DOI 10 1007 BF00201564Primitki red Human PubMed Reference HUGO Gene Nomenclature Commitee HGNC 6447 angl Arhiv originalu za 2 lyutogo 2017 Procitovano 30 sichnya 2017 UniProt P35527 angl Arhiv originalu za 7 lyutogo 2017 Procitovano 30 sichnya 2017 Div takozh red Hromosoma 17 nbsp Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Otrimano z https uk wikipedia org w index php title Keratin 9 amp oldid 36272318