SERPINA1 angl Serpin family A member 1 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 14 yi hromosomi 4 Dovzhina polipeptidnogo lancyuga bilka stanovit 418 aminokislot a molekulyarna masa 46 737 5 SERPINA1Nayavni strukturiPDBPoshuk ortologiv PDBe RCSBSpisok kodiv PDB1ATU 1D5S 1EZX 1HP7 1IZ2 1KCT 1OO8 1OPH 1PSI 1QLP 1QMB 2D26 2QUG 3CWL 3CWM 3DRM 3DRU 3NDD 3NDF 3NE4 3T1P 7API 8API 9API 4PYW 5IO1IdentifikatoriSimvoliSERPINA1 A1A A1AT AAT PI PI1 PRO2275 alpha1AT serpin family A member 1 nNIFZovnishni ID OMIM 107400 MGI 891968 HomoloGene 20103 GeneCards SERPINA1Pov yazani genetichni zahvoryuvannyaalpha 1 antitrypsin deficiency 1 Ontologiya genaMolekulyarna funkciya peptidase inhibitor activity protease binding GO 0001948 GO 0016582 protein binding identical protein binding serine type endopeptidase inhibitor activityKlitinna komponenta kompleks Goldzhi endoplasmic reticulum lumen COPII coated ER to Golgi transport vesicle ekzosoma endoplasmic reticulum Golgi intermediate compartment membrane platelet alpha granule lumen extracellular region endoplazmatichnij retikulum Golgi membrane extracellular space vnutrishnoklitinna membranna organela ficolin 1 rich granule lumen collagen containing extracellular matrixBiologichnij proces gemostaz negative regulation of peptidase activity platelet degranulation endoplasmic reticulum to Golgi vesicle mediated transport COPII vesicle coating acute phase response negative regulation of endopeptidase activity zsidannya krovi neutrophil degranulation posttranslyacijna modifikaciyaDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez5265 20703Ensembl ENSG00000197249ENSG00000277377 ENSMUSG00000071177UniProt P01009 Q00897P07758RefSeq mRNK NM 001127707NM 000295NM 001002235NM 001002236NM 001127700NM 001127701NM 001127702NM 001127703NM 001127704NM 001127705NM 001127706NM 009246RefSeq bilok NP 000286NP 001002235NP 001002236NP 001121172NP 001121173NP 001121174NP 001121175NP 001121176NP 001121177NP 001121178NP 001121179NP 033272NP 001239498NP 033269Lokus UCSC Hr 14 94 38 94 39 MbHr 12 103 73 103 74 MbPubMed search 2 3 VikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050MPSSVSWGILLLAGLCCLVPVSLAEDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQKA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do ingibitoriv proteaz ingibitoriv serinovih proteaz Zadiyanij u takih biologichnih procesah yak zsidannya krovi gemostaz gostra faza zapalennya Lokalizovanij u pozaklitinnomu matriksi endoplazmatichnomu retikulumi Takozh sekretovanij nazovni Literatura RedaguvatiLong G L Chandra T Woo S L C Davie E W Kurachi K 1984 Complete sequence of the cDNA for human alpha 1 antitrypsin and the gene for the S variant Biochemistry 23 4828 4837 PubMed DOI 10 1021 bi00316a003 Rosenberg S Barr P J Najarian R C Hallewell R A 1984 Synthesis in yeast of a functional oxidation resistant mutant of human alpha antitrypsin Nature 312 77 80 PubMed DOI 10 1038 312077a0 Ciliberto G Dente L Cortese R 1985 Cell specific expression of a transfected human alpha 1 antitrypsin gene Cell 41 531 540 PubMed DOI 10 1016 S0092 8674 85 80026 X The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PubMed DOI 10 1101 gr 2596504 Kolarich D Weber A Turecek P L Schwarz H P Altmann F 2006 Comprehensive glyco proteomic analysis of human alpha1 antitrypsin and its charge isoforms Proteomics 6 3369 3380 PubMed DOI 10 1002 pmic 200500751 Riley J H Bathurst I C Edbrooke M R Carrell R W Craig R K 1985 Alpha 1 antitrypsin and serum albumin mRNA accumulation in normal acute phase and ZZ human liver FEBS Lett 189 361 366 PubMed DOI 10 1016 0014 5793 85 81056 5Primitki Redaguvati Zahvoryuvannya genetichno pov yazani z SERPINA1 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 8941 angl Arhiv originalu za 14 zhovtnya 2017 Procitovano 6 lyutogo 2017 UniProt P01009 angl Arhiv originalu za 5 lyutogo 2017 Procitovano 6 lyutogo 2017 Div takozh RedaguvatiHromosoma 14 nbsp Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Otrimano z https uk wikipedia org w index php title Alfa 1 antitripsin amp oldid 35863817